KEGG   Edwardsiella piscicida C07-087: ETAC_05235Help
Entry
ETAC_05235        CDS       T02509                                 

Definition
(GenBank) Dihydrodipicolinate synthase
  KO
K01714  4-hydroxy-tetrahydrodipicolinate synthase [EC:4.3.3.7]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00261  Monobactam biosynthesis
etc00300  Lysine biosynthesis
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
etc01130  Biosynthesis of antibiotics
etc01230  Biosynthesis of amino acids
Module
etc_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    ETAC_05235
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    ETAC_05235
Enzymes [BR:etc01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.3  Amine-lyases
    4.3.3.7  4-hydroxy-tetrahydrodipicolinate synthase
     ETAC_05235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHDPS
Motif
Other DBs
NCBI-ProteinID: AGH73172
Position
1202785..1203666
Genome map
AA seq 293 aa AA seqDB search
MFTGSIVALVTPMDDKGNVDRASLKKLVDYHVASGTSAIVAVGTTGESATLSHDEHVNVV
LQTLELADGRIPVIAGAGANATAEAIALTERFNHSGVVGCLSVTPYYNKPTQEGLYQHFR
AIASCTDLPQILYNVPSRTGCDMLPETVARLAQIDNIIAIKEATGNLSRVGQIQDLVNDD
RFILLSGDDASALDFMRLGGKGVISVTANVAARQMAEMCRLTLAGDFHAARRLNLSLMPL
HRDLFIEANPIPVKWATKVLGLIATDTLRLPLTPLSASAHPAVERALQHAGVL
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgttcacgggaagtattgtagcgctggtaacgccgatggatgacaagggaaatgtcgat
cgcgcgagcctgaaaaagttggtcgattaccatgtcgccagcgggacgtccgccattgtt
gccgtgggcaccaccggtgagtccgccacgctgagccatgacgagcatgtcaacgtggtt
ttacagacgctggagctggccgatggccggattccggtgatcgccggggcgggcgctaac
gccaccgccgaggccattgcgctgaccgagcgttttaatcacagcggggtggtgggatgt
ctgtcggtcacgccgtattataataagccgacgcaggaagggttgtatcagcacttccgt
gccatcgcctcttgtaccgatctgccgcagattctgtataacgtgccgtcgcgcaccggt
tgcgatatgctgccggagaccgtggcgcgtttggcgcagattgacaatattatcgcgatt
aaagaagcgaccgggaacttaagccgcgttgggcagatccaagatctggtcaacgacgat
cgctttatcctgctcagcggtgatgatgcctcggcgctggactttatgcgtctgggcgga
aaaggggttatctcggtaaccgcgaacgtggccgcgcgccagatggcggaaatgtgccgc
ctgacgctggccggggatttccatgccgcacgcaggctaaacctgagcctgatgccgctg
catcgcgatctgtttatagaagcaaacccgataccggtaaaatgggccaccaaggtattg
ggactgatagcgaccgacaccctgcgtctgccgctgacaccgctgagcgccagtgcgcat
ccggcggttgagcgtgcactgcagcatgccggtgtgctgtaa

DBGET integrated database retrieval system