KEGG   Edwardsiella piscicida C07-087: ETAC_05245Help
Entry
ETAC_05245        CDS       T02509                                 

Definition
(GenBank) phosphoribosylaminoimidazole-succinocarboxamide synthase
  KO
K01923  phosphoribosylaminoimidazole-succinocarboxamide synthase [EC:6.3.2.6]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00230  Purine metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ETAC_05245
Enzymes [BR:etc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.6  phosphoribosylaminoimidazolesuccinocarboxamide synthase
     ETAC_05245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SAICAR_synt
Motif
Other DBs
NCBI-ProteinID: AGH73174
Position
1204877..1205590
Genome map
AA seq 237 aa AA seqDB search
MQKLAELYRGKAKTVYATEDPDLLILSFRNDTSALDGQRIEQFDRKGMVNNKFNHFIMSK
LEAAGIPTQMERLLSDTDALVKKLEMVPVECVIRNRAAGSLVKRLGIEEGMPLNPPLFDL
FLKNDAMHDPMVNESYCRTFGWVSDEHLAQMKALSYRANEVLSQLFDDAGLILVDFKLEF
GLYKGQVVLGDEFSPDGSRLWDKATLAKMDKDRFRQNLGGLIEAYEEVAHRLGVPLD
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagctcgctgagttgtaccgcggcaaggctaaaacggtctatgccacggaggat
ccggatctgctgattctgtcgttccgcaacgatacgtcagctctggatggccagcgcatt
gagcagtttgatcgcaagggtatggtgaacaacaagtttaatcacttcatcatgagcaag
ctggaggcggccgggatcccgacgcagatggagcgcctgctgtccgataccgatgcgctg
gtgaagaagctggagatggtgccggtggagtgcgtgatccgtaaccgcgccgccggttcg
ctggtgaagcgtctgggcattgaagagggcatgccgctgaatccgccgctgttcgatctg
ttcctgaagaacgacgccatgcacgatccgatggtcaatgaatcctactgccgtaccttt
ggctgggtcagcgacgagcatctggcgcagatgaaggcgctgagctaccgcgccaacgag
gtgctcagccagctgttcgacgacgccgggctgatcctggtggactttaagctggagttc
ggcctgtataagggccaagtcgttctgggcgatgagttttcgccggacggcagccgcctg
tgggataaggcgacgctggcgaagatggataaggatcgcttccgccagaacctgggcggg
ctgattgaggcctatgaagaggtggcccaccgtctgggcgtgccgctcgactga

DBGET integrated database retrieval system