KEGG   Edwardsiella piscicida C07-087: ETAC_05260Help
Entry
ETAC_05260        CDS       T02509                                 

Definition
(GenBank) hypothetical protein
  KO
K00641  homoserine O-acetyltransferase/O-succinyltransferase [EC:2.3.1.31 2.3.1.46]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00270  Cysteine and methionine metabolism
etc00920  Sulfur metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    ETAC_05260
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    ETAC_05260
Enzymes [BR:etc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     ETAC_05260
    2.3.1.46  homoserine O-succinyltransferase
     ETAC_05260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Esterase Peptidase_S9 Tannase Torsin
Motif
Other DBs
NCBI-ProteinID: AGH73177
Position
complement(1207069..1208133)
Genome map
AA seq 354 aa AA seqDB search
MRSTFRLLFLLLALISSALAQPLAPRHADWIARDFSFHDGARMDLTLHYRTLGDPDGMPV
LLLHGTGGSGDSFITPEFADVMFGPGQPLDIQRYFIIMPDAIGHGRSSKPSDGLRARFPR
YTYQDMVTAQFRLVTEGLGLPHLRLVMGNSMGGMHAWLWAERYPDAMDAVIPLAAQPTEM
ASRNWILRRLITDSIRRDPAWQNGDYRQQPPSAHFASVFYAIATSGGTLAWQRQAPTWDS
AQRLLEQRLSAPFSVDANDLLYQWDASRGYRADAHLEQVHAAVLAINAADDERNPPETGV
MQRAIARLPHGTLYLIPAGPETRGHATTGLARLYAPQVARFLLSAPSRRHHAAA
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgcgctccacttttcgtttattattcctactgttagcgctgatctccagcgcgctggcg
cagcccctcgcgccgcgccatgccgactggatcgcccgagacttttcctttcacgacggc
gcacgcatggatctgacgctgcactaccgcaccctgggcgatcccgacgggatgccggta
ctgctgctgcacggcaccggcggcagcggcgacagctttatcaccccggagttcgccgac
gtgatgttcggccccggtcagcccctcgatattcagcgctatttcatcatcatgccggac
gccatcggccacggccgctccagtaagccctccgatggactgcgcgcccgcttcccgcgc
tacacctatcaggacatggtcaccgcacagtttcgcctggtgacagagggactcggcctc
ccccacctgcgcctggtcatgggaaactccatgggcggaatgcacgcctggctctgggcc
gaacgctatcccgacgccatggacgcggtcattccactggccgcccagccgacggagatg
gcctctcgcaactggatactgcgccgcctgatcaccgacagcattcgccgagaccccgcg
tggcaaaacggcgactaccgtcagcagccgcccagcgcacactttgccagcgtcttctac
gccatcgccaccagcgggggaacgctagcctggcagcggcaggcgccgacctgggacagc
gcccagcggctgctggagcagcgcctgtccgcccccttcagcgtcgacgccaacgatctg
ctgtaccagtgggacgcctcgcgcggttaccgcgccgatgcgcatctggagcaggtgcac
gccgcggtgctggcgattaacgccgccgacgatgagcgaaacccgcccgagaccggcgtc
atgcagcgcgccatcgcacgcctgccgcacggcaccctctacctgatcccggcgggccca
gagacccgcggccacgccacgaccgggctggcgcgtctttatgcgccgcaggtcgcgcgt
tttctgctgagcgcgccgtcaaggaggcaccatgccgccgcatag

KEGG   Edwardsiella piscicida C07-087: ETAC_15190Help
Entry
ETAC_15190        CDS       T02509                                 

Definition
(GenBank) homoserine O-succinyltransferase
  KO
K00651  homoserine O-succinyltransferase/O-acetyltransferase [EC:2.3.1.46 2.3.1.31]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00270  Cysteine and methionine metabolism
etc00920  Sulfur metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01130  Biosynthesis of antibiotics
etc01230  Biosynthesis of amino acids
Module
etc_M00017  Methionine biosynthesis, apartate => homoserine => methionine
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    ETAC_15190
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    ETAC_15190
Enzymes [BR:etc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     ETAC_15190
    2.3.1.46  homoserine O-succinyltransferase
     ETAC_15190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTS TraC_F_IV
Motif
Other DBs
NCBI-ProteinID: AGH75159
Position
complement(3444417..3445346)
Genome map
AA seq 309 aa AA seqDB search
MPIRIPDALPAVNFLRNENVFVMTDSRAAVQEIRPLKVLLLNLMPKKIETENQFLRLLSN
SPLQIDIQLLRIDRRESKNTPTEHLNNFYCHFEDIQQENFDGLIVTGAPLGQVDFGDVAY
WSQIVRVITWARAHVTSTLFVCWAAQAALNVLYGLPKMTRTQKLSGVYEHQTLDPLALLT
RGFDDGFLAPHSRYADFPSQAIRTHTDLQIFAESVQAGAYLFASADKRTVFVTGHPEYDA
HTLGAEYWRDLHAGLAPALPFNYFPRDNPDGAPSATWRSHGHLLFSNWLNYCVYQITPYD
LRQMNPTLE
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgccaatcaggatccccgacgcgttgcccgccgttaattttttgcgtaatgaaaatgtc
tttgttatgaccgactctcgggccgcggtgcaggagattcgtccgctgaaggtgctgctg
ctgaatctgatgccaaagaaaatcgagactgaaaatcagtttctgcgtctgctgtcgaac
tcgccgctgcagatcgatattcagctgctgcgcatcgatcggcgcgagtcaaaaaatacg
ccgacggagcatctgaataacttttactgccattttgaggatattcagcaggaaaacttt
gatggtcttatcgtgaccggcgcaccgctggggcaggtggactttggcgatgttgcctat
tggtcgcagatcgtacgggttattacctgggcgcgggcgcacgtgacatccaccctgttc
gtctgctgggccgcccaggcggcgctcaatgtactgtatgggctacctaagatgacgcgg
acgcagaagctctccggggtgtatgagcatcagacgctcgatccgctggcgctgctgacc
cgcggctttgacgacggctttttggcgccgcactcgcgctatgccgactttccgtcgcag
gcgatccgcacgcataccgatctgcagatttttgccgagtctgtgcaggccggcgcctac
ctgtttgccagcgccgataagcggacggtgtttgtgacgggccatccggagtatgacgcc
cacacgctgggcgcggaatattggcgcgatctgcacgcgggcctggcgccggcgctgccg
ttcaactattttccccgcgacaacccagacggtgcgccgtcggcgacctggcgcagtcac
ggtcacctgctgttcagtaactggttgaactactgcgtttaccagataaccccttacgat
ctgcgtcagatgaatcccaccctggagtaa

DBGET integrated database retrieval system