KEGG   Edwardsiella piscicida C07-087: ETAC_05285Help
Entry
ETAC_05285        CDS       T02509                                 

Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00300  Lysine biosynthesis
etc01100  Metabolic pathways
etc01120  Microbial metabolism in diverse environments
etc01230  Biosynthesis of amino acids
Module
etc_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    ETAC_05285
Enzymes [BR:etc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     ETAC_05285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 Peptidase_M18
Motif
Other DBs
NCBI-ProteinID: AGH73182
Position
complement(1212049..1213182)
Genome map
AA seq 377 aa AA seqDB search
MSVCPVLTLAQQLIRCPSISPNDAGCQDILLARLRALDFHIEAMPHGDTRNLWAWRGGDG
PVLAFAGHTDVVPPGDECQWRHPPFTPTLQDGMLYGRGAADMKGSLAAMVVAAERFVSAR
PDHRGRLAFLITSDEEASAVNGTVRVVETLMARGERLDYCLVGEPSSEQRLGDVVKNGRR
GSITADLTVHGTQGHVAYPHLADNPVHRAAPMLAELVAIAWDNGNDFFPPTSLQIANIAA
GTGSNNVIPGDMYVQFNLRFSTESSVESIQQRVTALLDRHGLRYTLNWSLSGLPFLTPGG
ELVDAVVNAVACYGGQTPRLLTTGGTSDGRFIARMGAQVVELGPLNATIHKVNECVSAAD
LQSLSRMYQRIMEQLIA
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtctgtccggtcctcacgctggcgcagcagctgatccgctgcccgtcaatcagc
cccaacgacgccggatgccaggatatcctgctggcccgcctgcgcgcgctggactttcat
attgaagcgatgccgcacggcgatacccgcaatctgtgggcctggcgcggcggcgatggc
ccggtgctggcctttgccggccataccgacgtcgtaccgcccggcgatgaatgccagtgg
cgccaccccccgtttaccccgacgctgcaggacggcatgctgtacggccgcggcgcggcg
gatatgaagggatcgctggccgccatggtggtcgccgccgaacgctttgtctccgccagg
ccggatcaccgcggtcgactggcctttttaatcacctccgatgaggaggccagcgcggtc
aacggcaccgtccgcgtcgtcgagaccctgatggcgcgcggcgagcgccttgactactgc
ctggtgggtgagccctccagcgagcagcgtctgggcgacgtggtcaaaaacggccgccgc
ggctccatcaccgccgatctgaccgtgcacggcacccaggggcacgtcgcctatccccat
ctggccgacaatccggtgcaccgcgccgcgccgatgctggcggagctggtggcgatcgcg
tgggataacggcaacgacttcttcccgccgaccagcctgcagattgccaatatcgccgcc
ggtaccggcagcaataatgtgatccccggcgatatgtatgtacagttcaacctgcgtttc
agcaccgaatcgagcgttgagtcgatccagcaacgcgtaacggcgctgctggatcgacac
ggcctgcgctacaccctcaactggtccctctccggcctgccgttcctgacgccgggcggc
gagctggtcgacgcggtggtcaacgccgtcgcctgctacgggggccagaccccgcgtctg
ctgaccaccggcggcacatccgacgggcgtttcattgcccgcatgggtgcccaggtggtc
gaactggggccgcttaacgccaccatacataaagtcaacgaatgcgtcagcgcggccgac
ctacagagcctcagccgcatgtaccaacggattatggagcaactcatcgcatga

DBGET integrated database retrieval system