KEGG   Edwardsiella piscicida C07-087: ETAC_05295Help
Entry
ETAC_05295        CDS       T02509                                 

Definition
(GenBank) aminoglycoside/multidrug efflux system
  KO
K18324  multidrug efflux pump
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
Module
etc_M00646  Multidrug resistance, efflux pump AcrAD-TolC
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_05295
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_05295
Transporters [BR:etc02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   ETAC_05295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACR_tran MMPL SecD_SecF
Motif
Other DBs
NCBI-ProteinID: AGH73184
Position
complement(1214895..1218011)
Genome map
AA seq 1038 aa AA seqDB search
MAKFFIDRPIFAWVIAIIFSLAGLLAIHQLPIEQYPNLAPPTVRISASYPGASAQTLENT
VTQVIEQNMTGLDGLMYMSSQSSSSGSASITLTFQSGTDPNEAMQQVQNQLSAATRKLPQ
EVQLQGIRVSKSGDSSLMTVAFVSTDGSMDRQDIADYVASNLQDPLSRIDGVGSVDAFGS
QYAMRIWLDPTKLNQFRLTTQDVVSAIKSQNSQIAVGQIGATPAVPGQALNATLMAQSQL
QTPAQFRAITLRVNSDGSLVTLGDVAQVELGAEKYDYLSRFNGKPASGMSIKLASGANEL
ATDARVKAKLAQLEPYFPHGLKVEYAYETTPFVQAAIQDVVKTLFEAIALVFLVMYLFLQ
NLRATLIPTIAVPVVLLGTFAVLFAMGYSINTLTMFAMVLAIGLLVDDAIVVVENVERLM
SEEGLSPREATRKSMDQIQGALVGIALVLSAVFVPMAFFGGTTGAIYRQFSITIVSAMIF
SVLVALILTPALCATLLRPVNKTQLHAKKGFFGWFNRTFERSALRYENGVGRVVRNGGRS
MLLYLLILGGLGTLYLHLPTSFLPLEDRGVFMTQIQLPVGATQQETLKVVEKVERYLLVD
EGKDVQSVFSIVGAGPGGNGQNVARMFVRLKPWDQRIGDDDSAAAIIERASRAFANIREA
RVFASSPPAISGLGSSAGFDLELEDHAGLGHDALMQARDRLLAAAAKQPELTRVRHNGMD
DSPQLQVDIDQRKAQALGVSIDDINDTLKTAWGSTYVNDFLNRGRVKKVYVQGEAAYRML
PSDINKWYVRNSQGDMVPFSAFASTRWNYGSPRLERYNGEAAVEIVGEAAQGISTGRAMA
IMEQLVSELPSGFGLEWTGMSYQERLSGAQAPALYALSLLVVFLCLAALYESWSIPFSVM
LVVPLGVLGAVCATWLRGLENDVYFQVGLLTIIGLSAKNAILIVEFANELNRSGKDLLEA
TLEACRLRLRPILMTSLAFIFGVLPLTLSHGAGSGSQHAVGTGVLGGMIAATLLSIYFVP
LFFILVRRRFPGKDDRHR
NT seq 3117 nt NT seq  +upstreamnt  +downstreamnt
atggctaaatttttcatcgatcgccccatttttgcctgggtcatcgccatcatttttagc
ctggcggggctgctggccatccaccagctccccattgagcaatacccgaatctggcgccg
ccgacggtgcgcatcagcgcctcctaccccggcgcatcggcccagaccctggaaaacacc
gtgactcaggtcatcgaacagaacatgaccggcctggatgggctgatgtacatgtcctcc
cagagcagcagcagcggcagcgcctccattacgctgacctttcagtccggcaccgatccc
aatgaggcgatgcagcaggtccaaaatcagctcagcgccgccacccgtaaactgccgcag
gaggttcagctgcaggggatacgcgtcagcaaatccggcgacagtagcctgatgacggtc
gcctttgtctccaccgacggcagcatggatcgtcaggatatcgccgactatgtggccagt
aatctgcaggacccgctcagccgaatcgacggcgtcggcagcgtcgatgcgtttggctcc
cagtacgccatgcgtatctggctcgatcccaccaagctcaaccagttccgcctgacgacc
caagacgtcgtcagcgcgattaaaagtcagaacagccagatcgccgtcggccagatcggc
gccaccccggcggttcccggccaggcgctcaacgcgaccctgatggcacagtcccagctc
cagacgccagcgcagttccgcgcaataacgctgcgggtgaacagcgacggctctctggtg
acgctgggcgacgtggcccaggtcgagctgggcgctgaaaagtatgactatctgtcgcgc
ttcaacggcaaaccggcctccggaatgagcattaagctggcctccggcgccaatgagctg
gccaccgatgcgcgggtcaaggccaagctggcgcagctggagccctattttccccacggc
ctgaaggtggagtacgcctacgaaaccaccccctttgtccaggcggcgatccaggatgtg
gtcaaaaccctgtttgaggccatcgccctggtgtttctggtgatgtacctgttcctgcag
aacctgcgcgcgaccctgatcccgaccatcgccgtgccggtggtgctgctgggaaccttt
gccgtgctgtttgccatgggatacagcatcaacaccctgaccatgttcgccatggtgctg
gccatcggactgttggtcgacgatgccatcgtggtggtggaaaacgtcgaacgtctgatg
agcgaagagggactctcgccgcgggaggcgacgcgcaaatcgatggatcagatccagggg
gcgctggtggggatcgctctggtgctgtcggcggtcttcgtgccgatggccttcttcggc
ggcaccaccggcgcgatttatcgccagttctccatcaccatcgtctccgccatgatcttc
tcggtgctggtggcgctgatcctgacccccgccctgtgcgccaccctgctgcgaccggtc
aacaagacgcagctgcacgccaaaaaaggcttctttggctggtttaaccgcacctttgag
cgcagcgccctgcgctatgagaacggcgtgggccgggtggtacgcaacggtggacgcagc
atgctgctctatctgttgatcctcggcggactgggcacgctgtacctgcatctgcccacc
tcctttctaccgctggaggatcgcggggtcttcatgacccaaatccagctgccggtcggc
gctacgcagcaggagaccctgaaggtggtggaaaaggtagaacgctacctgctggtcgac
gagggcaaagacgtacagtcggtcttctccatcgtcggcgccgggccgggcggcaacggc
cagaacgtcgcgcgcatgttcgtgcgtctcaagccctgggatcagcgcatcggcgacgac
gacagcgccgccgccatcattgagcgcgccagccgggccttcgccaacattcgcgaagcg
cgggtctttgccagcagcccgccggccatctccgggctcggcagctccgccggcttcgat
ctggagctggaggatcacgccggtctcggtcacgatgcgctgatgcaggcccgcgatcgg
ctgctggccgccgcggccaagcagccggagctgacccgggtgcgccataacgggatggac
gacagcccgcagctgcaggtcgacatcgatcagcgcaaggcgcaggcgctcggcgttagc
atcgacgatattaacgacacgctgaaaaccgcctggggctcaacctacgtcaacgacttt
ctcaaccggggacgggtgaagaaggtctatgtgcagggcgaggccgcctaccgcatgctg
ccgtcagacattaacaaatggtatgttcggaatagccaaggcgatatggtgcccttctcc
gcctttgccagcacccgctggaactacggctctccgcgtctggaacgctataacggcgag
gcggcggtcgaaatcgtcggcgaggcggcgcaggggatcagcaccggccgcgccatggcg
atcatggaacagctggtcagcgaactgcccagcggatttggcctagagtggaccggcatg
tcctatcaggagcgcctctccggcgcccaggcaccggcgctgtacgccctctccctgctg
gtggtattcctctgtctggcggcgctgtatgaaagctggtcgatccccttctcggtcatg
ctggtggtgccgctcggcgtgctgggcgccgtctgcgccacctggctgcgcgggctggaa
aacgatgtctatttccaggtggggctgctgaccatcatcggcctgtcggcgaaaaacgcc
attttgatcgtcgagttcgccaacgaactcaatcgcagcggcaaagatctgctggaggcg
acgctggaggcgtgtcgcctgcgcctgcgcccgatcctgatgacctcgctggccttcatc
ttcggcgtactgccgctgacgctcagccacggcgcgggctccggcagccagcacgcggtc
ggtaccggggtgctgggcggcatgatcgccgccaccctgctgtcgatctactttgttccg
ttgttctttattctggtgcgccgccgctttcccggtaaggacgatcgacatcgataa

DBGET integrated database retrieval system