KEGG   Edwardsiella piscicida C07-087: ETAC_05305Help
Entry
ETAC_05305        CDS       T02509                                 

Definition
(GenBank) Nitrate/nitrite response regulator protein
  KO
K07685  two-component system, NarL family, nitrate/nitrite response regulator NarP
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
Module
etc_M00472  NarQ-NarP (nitrate respiration) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_05305
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:etc02022]
    ETAC_05305
Two-component system [BR:etc02022]
 NarL family
  NarQ-NarP [MD:M00472]
   ETAC_05305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg GerE Sigma70_r4 Sigma70_r4_2 HTH_24 HTH_23 HTH_28 HTH_10 HTH_20 HTH_Tnp_ISL3 HTH_AsnC-type HTH_29 CENP-B_N HTH_5 HTH_38 HTH_12 CREPT HTH_40 HTH_11 HTH_1 RPA_C
Motif
Other DBs
NCBI-ProteinID: AGH73186
Position
complement(1218743..1219351)
Genome map
AA seq 202 aa AA seqDB search
MIVDDHPLMRRGVRQLLELDSVFSVVAEASNGSEAIALAERSQPDLILLDLNMKGLSGLD
TLKALRNEGIDARIIILTVSDARSDVYALVDAGADGYLLKDSEPEALLAQIRQAAEGRSV
FSESVLAYLSTRSEIADPLADLTERELDVLQEVARGMSNKQIAAQLHISEETVKVHIRNL
LRKLNVRSRVAATVLYLEYKNS
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtcgacgatcacccgctgatgcgccgcggagttcgtcagctgttggaactggac
agcgtcttcagcgtggtcgccgaagccagcaacggcagcgaggccattgccctggccgaa
cgcagccagccggatctgatcctgctggatctcaatatgaagggattatcggggctggat
acgctgaaggccctgcgcaatgagggcatcgacgcccgcattatcattctgaccgtctcc
gacgcccgcagcgacgtgtatgcgctggtcgacgccggcgccgacggctatctgctgaag
gacagcgaacccgaggcgctgctggcccagatccgccaggcggcggaggggcgctcggtg
ttcagcgagtcggtgctcgcctacctgagcacccgcagcgaaatcgccgatccgctggcc
gacctgaccgaacgcgagctggatgtcctgcaggaggtggctcgcggcatgtccaacaag
cagatcgccgcgcagctgcacatctcggaggagaccgtcaaggtgcacatccgcaacctg
ctgcgcaagctcaacgtccgctcccgcgtggccgccacggtgctgtacctggagtacaaa
aacagctga

DBGET integrated database retrieval system