KEGG   Edwardsiella piscicida C07-087: ETAC_05310Help
Entry
ETAC_05310        CDS       T02509                                 

Definition
(GenBank) nitrate/nitrite sensor protein NarQ
  KO
K07674  two-component system, NarL family, nitrate/nitrite sensor histidine kinase NarQ [EC:2.7.13.3]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
Module
etc_M00472  NarQ-NarP (nitrate respiration) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_05310
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:etc01001]
    ETAC_05310
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:etc02022]
    ETAC_05310
Enzymes [BR:etc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     ETAC_05310
Protein kinases [BR:etc01001]
 Histidine kinases
  NarL family
   ETAC_05310
Two-component system [BR:etc02022]
 NarL family
  NarQ-NarP [MD:M00472]
   ETAC_05310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PilJ HisKA_3 HATPase_c HAMP HATPase_c_2
Motif
Other DBs
NCBI-ProteinID: AGH73187
Position
complement(1219446..1221146)
Genome map
AA seq 566 aa AA seqDB search
MLVKRSVTSTLARALIAMVILSVLSTGIALLTVASSINDAEAVNIAGSLRMQSYRLAYDL
TSQPQDIARHLQEYGQSLRAPALQKLTRFYVPTSVRDEYTQLLDTWQELDIQLRQGHSQA
FLHGVAHYVDQIDHFVLVLQHYAEQKMEQVVLISLVGLLALIGLVWFSIRTIRREVVAPL
NKLVSASIRMQNGHFAPLQLDVNLPNEMGVLSKAFVRMSGELEKLYRSLEEKVQEKTESL
TQANRTLGVLFEASQALTVSQITQPSFEQVLNIVRSSEALDFLQLEVIDSGQGRWLLASG
PTDEREPTQELPLMLDGQPLGALRWPARQSPQMQLMQNVANMLSRGVYFNRAQKQQLQLL
LMEERATIARELHDSLAQALAFLRIQITLLRRATDADNHPAQAIIRDFDQALSDAYRQLR
ELLATFRLTIEEADLREALQQLLAPLKLQTDARITLHCALSSQSLNAQQQVHVLQIVREA
TLNAIKHAQAQHITLSCCCRDDGANVISVTDDGIGLPSAEEPPGHYGLTIMAERAARLGG
ELHITPGPDGGTRVTLIFRPPTGDGI
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
gtgttggtaaaacgctccgtgaccagtaccctggcacgcgccctgatcgccatggtgatc
ctctccgttctgtcgaccgggatcgccctgctgacggtcgccagcagcatcaacgatgcc
gaggcggtcaatattgccggctcgctgcgcatgcagagctaccgtctggcctacgacctc
accagccagccccaggatatcgcccgccacctgcaggagtacggccagtcgctgcgcgcc
ccggcgctgcaaaagctcacccgcttttatgtgccaacgtcggtacgcgacgaatatacc
cagctgctggatacctggcaggagctggacattcagctgcgccaagggcatagccaggcc
tttctgcacggcgtcgcccactatgtcgatcagatcgaccatttcgtgctggtgctgcag
cattacgccgaacagaagatggagcaggtggtgctgataagcctggtcgggctgctggcg
ctgatagggctggtctggttctccatccgcaccatccgccgcgaggtggtcgcgccgctc
aacaagctggtctccgccagcatccgcatgcaaaacggccacttcgctccgctgcagctg
gacgtcaatctgcccaatgaaatgggggtgctctccaaggcctttgtgcgcatgtccggt
gagctggagaagctgtaccgctccctggaagagaaagtgcaggagaagaccgagagcctg
actcaggccaaccgtaccctgggggtactgtttgaggcctcgcaggcgctgaccgtcagc
cagataacccagcccagctttgagcaggtgctgaacatcgtgcgcagcagcgaggcgctc
gacttcctgcagctggaggtgatcgacagcggccagggccgctggctgctcgccagcggc
cccacggatgaacgcgagcctacccaggaactgcccctgatgctggacggacagccgctc
ggcgcgctgcgctggcccgcgcggcagtcgccgcagatgcagctgatgcagaacgtcgcc
aacatgctcagccgcggggtctacttcaatcgggcgcaaaagcagcagctgcagctgctg
ctgatggaggagcgggccaccatcgcccgcgagctgcacgactccctggcccaggcgctg
gctttcctgcgtatccagataaccctgctgcggcgggcaaccgatgccgacaaccacccg
gcgcaggcgattattcgcgacttcgatcaggcgctcagcgatgcctaccgccagctgcgc
gagctgctggccaccttccgactgaccatcgaagaggccgatctgcgcgaggcgttgcaa
cagctactggcgccgctaaaattacagaccgacgcgcggattacgctacactgtgcgctc
tcctctcagtcgctgaacgcacagcagcaggttcacgtgttgcaaatcgtccgagaagcg
acgctcaacgcgatcaagcacgcccaggcgcagcacattaccctgagctgctgctgtcgt
gacgacggtgccaacgtgatcagcgtcaccgacgacggcatcggcctgcccagcgccgag
gagccgcccggtcactatggcctgaccatcatggccgagcgcgccgcccgtcttggggga
gaactgcatatcaccccgggccccgacggcgggacgcgggtaaccttgatctttcgtccc
cctaccggcgacgggatctga

DBGET integrated database retrieval system