KEGG   Edwardsiella piscicida C07-087: ETAC_05350Help
Entry
ETAC_05350        CDS       T02509                                 

Definition
(GenBank) ribose 5-phosphate isomerase B, putative
  KO
K01808  ribose 5-phosphate isomerase B [EC:5.3.1.6]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00030  Pentose phosphate pathway
etc00051  Fructose and mannose metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
etc01130  Biosynthesis of antibiotics
etc01200  Carbon metabolism
etc01230  Biosynthesis of amino acids
Module
etc_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
etc_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ETAC_05350
   00051 Fructose and mannose metabolism
    ETAC_05350
Enzymes [BR:etc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     ETAC_05350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LacAB_rpiB DUF2000 PTS_IIB
Motif
Other DBs
NCBI-ProteinID: AGH73195
Position
complement(1227517..1227996)
Genome map
AA seq 159 aa AA seqDB search
MLPIAIGADDAAIALKETLVAYLQQRHIPFTDYTDAIRDSDYPDIAVRVAQAIRDAHHLR
GILLCGTGIGMSIMANKVPGIRAAQCHDTYSAQRARKSNDAHIITLGARVIGPELAKAIV
DAWLIAEFEGGGSTIKVAKIGDYEQIFSEKYPRRAEDKR
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgctaccgattgccattggcgccgatgatgccgctattgcccttaaagaaacgctcgtt
gcatatctacagcagcgtcatattccctttactgattacacggatgcaatccgcgatagc
gactaccccgatattgccgtccgggtcgctcaggcaatcagagacgcgcatcatctgcga
gggatcctgctatgtggtaccggcattggcatgagcattatggcgaataaggtgccgggg
atccgggcagcacagtgccacgatacctattcagcccagcgagcgcgtaaaagcaatgat
gcccacatcattacgctaggcgcccgcgtcatcggccccgaactggcgaaagcgatcgtt
gatgcctggctaatagccgaatttgaaggtggggggtcgacgataaaagtcgctaaaatt
ggcgattatgagcaaatatttagtgagaaatacccgcggcgagctgaggataaacgctag

KEGG   Edwardsiella piscicida C07-087: ETAC_14200Help
Entry
ETAC_14200        CDS       T02509                                 

Definition
(GenBank) ribose 5-phosphate isomerase A
  KO
K01807  ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00030  Pentose phosphate pathway
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
etc01130  Biosynthesis of antibiotics
etc01200  Carbon metabolism
etc01230  Biosynthesis of amino acids
Module
etc_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
etc_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ETAC_14200
Enzymes [BR:etc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     ETAC_14200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rib_5-P_isom_A DeoRC RNase_PH_C
Motif
Other DBs
NCBI-ProteinID: AGH74961
Position
complement(3204838..3205497)
Genome map
AA seq 219 aa AA seqDB search
MTQDELKKAVGWAALKYVQPGTIVGVGTGSTASHFIDALATMKGQIEGAVSSSDASTAKL
KSLGIPVFDLNEVDALDIYVDGADEINGAMQMIKGGGAALTREKIVAAVAKKFVCIVDAS
KQVDILGNFPLPVEVIPMARAYVARELVKLGGQPVYRQGVLTDNGNVILDVHNLQIMEPC
KLENAINAIAGVVTVGLFANRGADVALVGCADGVKTLTL
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaggatgaattgaaaaaagcagtgggttgggcagcgctgaagtatgtgcagcct
gggaccattgtcggggtaggcaccggctccaccgcctctcactttattgatgcgctggcg
accatgaagggccagatcgagggcgcggtctccagctctgatgcctccaccgccaagctg
aaaagtctggggatcccggtctttgacctcaacgaggtggatgcgctggatatctacgtg
gatggggccgatgagatcaacggcgccatgcagatgatcaagggcggcggcgccgcgctg
acgcgtgagaagatcgtggcggcggtggccaagaagttcgtctgcatcgtcgatgcctct
aagcaggtcgatattctgggtaacttcccgctgccggtcgaggtgatcccgatggcgcgc
gcctacgtcgcccgtgagttggtgaagctgggcggacagccggtgtatcgccagggcgtg
ctgaccgataacggcaacgtgatcctggatgtacacaacctgcagatcatggagccgtgc
aagctggagaacgccattaacgctatcgccggcgtcgtgacggtggggctgtttgccaac
cgtggcgccgacgttgcgctggtcggctgcgccgatggggtcaaaacgctgaccctgtaa

DBGET integrated database retrieval system