KEGG   Edwardsiella piscicida C07-087: ETAC_05390Help
Entry
ETAC_05390        CDS       T02509                                 

Definition
(GenBank) bifunctional malic enzyme oxidoreductase/phosphotransacetylase
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00620  Pyruvate metabolism
etc01100  Metabolic pathways
etc01120  Microbial metabolism in diverse environments
etc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ETAC_05390
Enzymes [BR:etc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     ETAC_05390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTA_PTB malic Malic_M Amidase_2
Motif
Other DBs
NCBI-ProteinID: AGH73203
Position
1235273..1237552
Genome map
AA seq 759 aa AA seqDB search
MDEKLKQSALEFHQYPVAGKIQVVPTKPLATQRDLALAYSPGVAAPCLEIADDPLAAYKY
TARGNLVGVISNGTAVLGLGNIGALAGKPVMEGKGVLFKKFAGIDVFDIEVDEHDPDKLI
EVIAALEPTFGGINLEDIKAPECFYIEKKLRERMKIPVFHDDQHGTAIICTAAVLNGLRV
VDKPIDRVRLVVSGAGASAIACLNLLVALGLKRENITACDSKGVIYRGRDAHLVESKAAY
AIDDNGWRTLADAIPGADIFLGCSGPGVLTQEMVKTMAPSPLILALANPEPEILPPLAKA
VRPDAIICTGRSDFPNQVNNVLCFPFIFRGALDVGATTINEEMKLAAVRAIADLALAEQS
EVVASAYGDQSLSFGPEYIIPKPFDPRLIVKIAPAVAQAAMDSGVATRPIDDMDGYIEHL
TEFVYKTTLFMKPVFSQARQDPKRVVLAEGESERVLHATQEMVTLGLAKPILIGRPQVIA
HRLEKLGLHIEIGRDVEVVNNESDPRYNDYWQTYYGIMKRRGISQAQARRALIADPTVIA
AIMVKRGEADAMICGTEGNYQDHYRVVREVFGYRDGCHTAAAMNALLLPSGNTFIADTYV
NEDPSAEQLAEIVLMSADAVRRFGIEPKVALLSHSNFGTADCPSSRKMRRVLELVQQAAP
GLEIDGEMHGDAALVESIRLGQMPDSPLKGAANILIMPNMEAARISYNLLRVSSSEGVTV
GPVLMGISKPVHILTPIASVRRIVNMVALSVVEAQSRAL
NT seq 2280 nt NT seq  +upstreamnt  +downstreamnt
atggatgaaaaattaaaacaaagtgcgcttgagtttcatcagtatcccgttgcggggaaa
atccaggttgttcccaccaagccgctggcgacccagcgcgatttggcgctggcctattca
ccgggcgttgccgcgccctgtctggagatcgccgacgatccgttagcggcctataagtat
accgcgcgcggaaatctggtgggggtcatctctaacggtaccgccgtgctggggctcggc
aacatcggcgccctggccgggaagccggtgatggaaggtaaaggggtgctgttcaagaag
ttcgccggtatcgacgtgtttgatattgaggtggatgaacacgatcctgacaagctgatc
gaggtgatcgccgcgctggagcccacctttggcggcatcaaccttgaagacatcaaggcg
ccggagtgtttctatattgaaaagaaactgcgcgagcggatgaaaatcccggtgttccac
gacgaccagcacggcacggcgatcatctgcaccgccgccgtactcaacggcctgcgggtg
gtcgacaaaccgatcgaccgggtgcggctggtggtctccggcgccggcgcatcggcgatc
gcctgtctgaacctgctggtggcgctggggctgaagcgtgaaaatatcaccgcctgcgac
tccaaaggggtgatttaccgcgggcgtgacgcgcacctggtcgagagcaaggcggcctat
gccatcgatgacaatggctggcgtacgctggcggatgcgatccccggcgcggatattttc
ctgggctgctccggccccggggtactgacgcaggagatggtgaaaaccatggcgccgtcg
ccgctgatcctggcgctggctaacccggagccggagatcctgccaccgctggccaaggcg
gttcgccccgatgcgataatctgtaccggccgctccgacttccctaaccaggtgaacaac
gtgctgtgcttcccgttcatcttccgcggtgcgctggacgtcggggcgaccaccatcaat
gaagagatgaagctggcggcggtgcgcgccattgccgatctggcactggcggagcagagc
gaggtggtcgcctctgcctacggcgatcagtcgctctccttcggcccggagtacattatt
cccaaacccttcgatccgcggctgatcgtgaagattgcgccggcggtggcgcaggcggcg
atggactccggggtggcgacgcgtcctatcgatgatatggatggctatatcgagcacctg
accgagtttgtctacaagaccaccctgtttatgaagccggtattttcccaggcgcgtcag
gatcccaagcgggtcgtgttggccgagggtgagtcggagcgcgtgctgcacgccacccag
gagatggtgacgctggggctggccaagccgatcctgatcgggcgcccgcaggtcatcgct
caccggttagagaagctcgggctgcacatcgagatcggccgcgatgtcgaggtggtcaat
aacgaatccgatccgcgctataacgactattggcaaacctattacggcatcatgaagcgg
cgcgggatctcgcaggcgcaggcgcgccgggcgctgatcgccgatccgacggtgatcgcg
gcgatcatggtcaagcgcggcgaggccgacgcgatgatctgcggtaccgagggcaactac
caagatcactatcgcgtggtgcgtgaggtgttcggctaccgcgacggatgccatacggcc
gccgcgatgaatgccctgctgctgccgagcggcaacacctttatcgccgatacctatgtt
aatgaggacccgagcgccgagcagctggcggagattgtgctgatgtccgccgacgcggtg
cgtcgcttcggtatcgagccgaaggttgcgctgctctcccactccaactttggcacggcc
gactgcccgtcatcgcgcaaaatgcgccgggtactggagctggtgcagcaggcggcgccg
gggttggagatcgacggtgagatgcacggcgacgcggcgctggtggagagcattcgtctg
gggcagatgccggatagcccgctgaaaggggcggcgaatatcctgatcatgcccaatatg
gaggccgcgcgcatcagctataacctgctgcgggtctcctcatccgagggggttaccgtc
gggccggtgctgatggggatcagtaagccagtgcatatcctgacgccgatcgcctccgta
cgccgcatcgtcaatatggtggcgctgtcggtggtggaggcgcagagcagggcgctgtag

KEGG   Edwardsiella piscicida C07-087: ETAC_05560Help
Entry
ETAC_05560        CDS       T02509                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00027  malate dehydrogenase (oxaloacetate-decarboxylating) [EC:1.1.1.38]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00620  Pyruvate metabolism
etc01200  Carbon metabolism
etc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ETAC_05560
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_05560
Enzymes [BR:etc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.38  malate dehydrogenase (oxaloacetate-decarboxylating)
     ETAC_05560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malic_M malic
Motif
Other DBs
NCBI-ProteinID: AGH73237
Position
complement(1276591..1278288)
Genome map
AA seq 565 aa AA seqDB search
MDLEHESKRPLYIPYAGPILLEFPLLNKGSAFSEEERNNFNLSGLLPEAIETIEEQVERA
YRQFCDFQNATAQHIYLRNIQDTNETLFYRLLRGHLSEMMPIIYTPTVGEACEHFSDIYR
RARGLFIAYPNRDRIDDMLQNATKQNVKVIVVTDGERILGLGDQGIGGMGIPIGKLSLYT
ACGGISPAYTLPVVLDVGTNNPQRLNDPLYMGWRHPRITGDEYNAFVEAFIQAVKRRWPD
VLLQFEDFAQKNAMPLLSRYRDQLCCFNDDIQGTAAVTLGSLIAASRAAGSRLRDQTITF
LGAGSAGCGIAEQIIAQMIAEGLSDEEARARIFMVDRFGLLTDRLPNLLDFQSRLVQKQQ
ALAGWQTESEGISLLDVVRNAHPTVLIGVSGQPGLFSEAIVREMHSHCPRPIIMPLSNPT
SRVEARPEDIINWTDGAALVASGSPFDPVLYQGERYPIAQCNNAYIFPGIGLGVLASGAR
RVTDGMLMAASRALADSSPLARDGHGPLLPDLKDIQQVSRDIAFQVAKAAQRQGVAVLTS
DEALLQAIDHNFWLPIYRSYKRTSF
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atggatctggaacacgaaagtaaacgtccgctgtatattccctatgccggccccatcctg
cttgaattcccgctgttgaataaaggcagcgccttcagcgaagaagagcgcaataacttt
aacctgagcggcctgttgcctgaggccatcgaaaccatcgaagagcaggttgagcgcgcc
tatcgccagttttgcgattttcagaacgccaccgcgcagcatatctacctgcgcaatatt
caggacaccaacgagaccctgttctaccgcctgctgcgcggccaccttagcgagatgatg
cccatcatctataccccgacggtcggtgaggcctgtgagcacttttccgatatctaccga
cgcgcccgcgggctgtttatcgcctatcccaaccgcgatcgcatcgatgacatgctgcaa
aacgccaccaagcagaacgtaaaggtgattgtggtcaccgatggcgagcgcatcctcggc
ctgggcgatcagggcatcggcggcatggggattcctatcggtaaactgtcgctgtacacc
gcctgcggcggcatcagcccggcctatactctgcccgtggtgctggacgtcggcaccaat
aacccacagcgcctcaacgatccgctgtatatgggctggcgccacccgcgcatcaccggc
gatgaatataacgcgttcgtcgaggcgttcattcaagcggtcaagcgccgctggccggat
gttctgctgcagtttgaggacttcgctcagaaaaatgccatgccgctgctgagccgctat
cgcgatcagctctgctgctttaacgacgacattcagggcaccgcggccgtcaccctgggc
agcctgatcgccgccagtcgcgccgccggcagtcgtctgcgcgatcagaccattaccttc
ctcggcgccggatctgccggatgcggcatcgcggaacagatcatcgcccagatgatcgcc
gaggggctgagcgacgaagaggcgcgggcgcgcatcttcatggtcgatcgcttcggactg
ctaaccgatcgcctgcccaacctgctcgacttccagagccgcctggtacaaaaacagcag
gcgctggccggatggcagacggagagcgaggggatctccctgctcgacgtggtacgcaac
gcccaccccacggtgctgatcggcgtatcgggtcagccggggctgttcagcgaggcgatc
gtgcgcgaaatgcacagccactgcccccgccccatcatcatgccgctctccaaccccacc
tcccgggtagaggcccgtccagaggatatcatcaactggaccgatggcgcggcgctggtc
gccagcggcagccccttcgacccggtgctctatcagggagagcgctacccgatagcccag
tgtaacaacgcctatatcttccccggcatcggcctgggcgtcctggccagcggtgcgcgg
cgggtgaccgacggcatgctgatggccgccagccgcgcgctggccgacagctcgccgctg
gcgcgcgacggccacggccccctgctaccggatctgaaggatatccagcaggtttcacgc
gacatcgcctttcaggtcgccaaggcggcccagcgccagggcgtcgcggtgctgacctca
gacgaggcgctgctgcaggccattgaccataacttctggctgccgatataccgtagctat
aagcgaacctcgttctaa

DBGET integrated database retrieval system