KEGG   Edwardsiella piscicida C07-087: ETAC_05430Help
Entry
ETAC_05430        CDS       T02509                                 

Definition
(GenBank) PTS system glucose-specific transporter subunit IIA
  KO
K02777  PTS system, sugar-specific IIA component [EC:2.7.1.-]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00010  Glycolysis / Gluconeogenesis
etc00500  Starch and sucrose metabolism
etc00520  Amino sugar and nucleotide sugar metabolism
etc01100  Metabolic pathways
etc02060  Phosphotransferase system (PTS)
Module
etc_M00265  PTS system, glucose-specific II component
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ETAC_05430
   00500 Starch and sucrose metabolism
    ETAC_05430
   00520 Amino sugar and nucleotide sugar metabolism
    ETAC_05430
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    ETAC_05430
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_05430
Enzymes [BR:etc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.-  
     ETAC_05430
Transporters [BR:etc02000]
 Phosphotransferase System (PTS)
  Enzyme II [TC:4.A]
   Glucose-specific II component [MD:M00265]
    ETAC_05430
   Maltose/glucose-specific II component [MD:M00266]
    ETAC_05430
   Maltose-specific II component [MD:M00806]
    ETAC_05430
   Beta-glucoside (arbutin/salicin/cellobiose)-specific II component [MD:M00272]
    ETAC_05430
   Trehalose-specific II component [MD:M00270]
    ETAC_05430
   N-Acetylmuramic acid-specific II component [MD:M00303]
    ETAC_05430
   Alpha-glucoside-specific II component [MD:M00268]
    ETAC_05430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTS_EIIA_1 Biotin_lipoyl_2 RnfC_N
Motif
Other DBs
NCBI-ProteinID: AGH73211
Position
complement(1243486..1243995)
Genome map
AA seq 169 aa AA seqDB search
MGLFDKLKSLVSDDKKETGSIEIFAPLSGEIVNIEDVPDVVFAEKIVGDGIAIKPTGDKM
VAPVDGTIGKIFETNHAFSIESDSGVELFVHFGIDTVELKGEGFKRIAEEGQRVKKGDVV
IEFDLPLLEEKAKSTLTPVVISNMDEIKELIKLSGDVVVGETPVIRIKK
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgggtttgttcgataaactgaaatcgctggtttcagacgacaagaaagaaacgggcagc
attgagatttttgcgcccctgtccggtgagatcgtcaatattgaagatgtgcctgacgtc
gtctttgctgaaaagatcgtcggtgacggcatcgcaatcaaaccgaccggtgacaaaatg
gtcgccccggttgatggcaccatcggtaaaatctttgaaactaaccatgctttctctatc
gagtccgacagcggcgtagagctgtttgtacacttcggcatcgataccgttgaactgaaa
ggcgaaggcttcaagcgcatcgccgaagaaggtcagcgcgtgaagaagggcgacgtggtc
atcgagttcgatctgccgctgctggaagagaaggccaagtctaccctgacgccggtcgtc
atctccaacatggatgagatcaaggagctgatcaagctgtccggcgacgttgtcgtcggc
gaaacgccggtgatccgcatcaagaagtaa

DBGET integrated database retrieval system