KEGG   Edwardsiella piscicida C07-087: ETAC_05445Help
Entry
ETAC_05445        CDS       T02509                                 

Definition
(GenBank) cysteine synthase
  KO
K01738  cysteine synthase [EC:2.5.1.47]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00270  Cysteine and methionine metabolism
etc00920  Sulfur metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
etc01130  Biosynthesis of antibiotics
etc01200  Carbon metabolism
etc01230  Biosynthesis of amino acids
Module
etc_M00021  Cysteine biosynthesis, serine => cysteine
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    ETAC_05445
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    ETAC_05445
Enzymes [BR:etc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.47  cysteine synthase
     ETAC_05445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AGH73214
Position
complement(1246466..1247425)
Genome map
AA seq 319 aa AA seqDB search
MSKIYQDNSHTIGHTPLVRLNHIGNGRILAKVESRNPSFSVKDRIGANMIWDAEKRGILK
PGVELVEPTSGNTGIALAFVAAARGYKLTLTMPETMSLERRKLLKGLGAELILTDGALGM
KGAISKAESIVASDPARYVMLQQFSNPANPEIHRQTTGPEIWQDTDGQVDVFIAGVGTGG
TLTGTARYLKQDRAKNVSIVAVEPDDSPVISQAIAGEPIVPGPHKIQGIGAGFIPDNLDL
ALVDRVERIGNDEAIAMARRLMREEGILAGISSGAAVAAAERLANMPAFQEKTIVVILPS
SGERYLSTALFAGLFPEPE
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaatctatcaagataactcccataccatcggacataccccgctggtacgtctc
aatcatatcggcaacgggcgtatcctggccaaagtggagtcgcgcaatcccagcttcagc
gttaaagatcgcatcggcgccaacatgatctgggacgccgaaaagcgcggtattctgaag
cccggcgtcgagctggttgagccgaccagcggcaacaccggcatcgctctcgcctttgtc
gccgcggcccgcggctacaagctgaccctgaccatgcccgaaaccatgagcctggagcga
cgtaagctgcttaaggggctgggagccgagctgattctgaccgacggcgccctgggaatg
aaaggggctatcagcaaagccgaatcgattgtcgccagcgatccggcgcgctatgtcatg
ctgcagcagttcagcaatccggccaaccccgagatccaccgccagaccaccgggccggaa
atctggcaggataccgatggccaggttgatgtcttcatcgccggcgtcggcaccggtggc
accctgaccggcaccgcccgctatctgaagcaggatcgcgctaaaaatgtcagcattgtg
gctgtcgagccggacgactctccggtgatcagccaggcgatcgccggggaacccattgtc
cccggaccgcacaaaatccaaggcatcggcgccggttttattcccgataacctcgattta
gcgctggtcgatcgcgtagagcgcatcggcaacgatgaggccatcgccatggcgcgccgc
ctgatgcgtgaagagggtatcctcgccggaatctcctccggcgccgccgtcgccgcagcc
gaacggctggccaatatgccggcgttccaggagaaaaccatcgtggtgatcctgccctcc
tcgggcgaacgttatctgagcaccgccctgtttgccggcctgtttcccgagccggaatga

DBGET integrated database retrieval system