KEGG   Edwardsiella piscicida C07-087: ETAC_05495Help
Entry
ETAC_05495        CDS       T02509                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00010  Glycolysis / Gluconeogenesis
etc00052  Galactose metabolism
etc00500  Starch and sucrose metabolism
etc00520  Amino sugar and nucleotide sugar metabolism
etc00521  Streptomycin biosynthesis
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
etc01130  Biosynthesis of antibiotics
etc01200  Carbon metabolism
Module
etc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
etc_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ETAC_05495 (glk)
   00052 Galactose metabolism
    ETAC_05495 (glk)
   00500 Starch and sucrose metabolism
    ETAC_05495 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    ETAC_05495 (glk)
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ETAC_05495 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    ETAC_05495 (glk)
Enzymes [BR:etc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     ETAC_05495 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: AGH73224
Position
1259448..1260413
Genome map
AA seq 321 aa AA seqDB search
MSRFALVGDVGGTNARLALCCLDTGCLQAVQSYPGQQFDSLESVIRTYLQAQAVSVTSAC
IAIACPITGDRVAMTNHSWAFSISAMQRSLGLAHLSVINDFTAVSMAVPVLPAESLLQLG
GQTAQPDRPIAIYGAGTGLGVAHLIRAGDRWISLPGEGGHVDFATGSDEEDALLTALRAD
LGRVSAERVLSGPGLVNLYRAVARVAGRTPQSLTPQEVSERALADRCPDCRRALSLFCVM
MGRFGGNLALNMGTFGGVYIAGGIVPRFLAFFRDSGFRQAFEDKGRFKAYLAPIPVFLIV
HDNPGLLGAGAYLRQQLGTHL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgagccgttttgcgttggttggcgatgtgggcgggaccaatgcccgcctggcgctgtgc
tgtctcgacaccgggtgtctccaggcggtgcagagctacccgggacagcagttcgatagc
ctggagtcggtcatccggacttacctgcaggcgcaggcggtatcggtgacgtcggcctgt
atcgccatcgcctgcccgatcaccggcgatcgcgtggcgatgaccaatcacagctgggcg
ttttccatcagcgcgatgcagcgttcgctggggttggcgcacctgtcggtgatcaacgac
tttaccgcggtctccatggcggtgccggtgctccccgcggagagtctgctgcagctgggc
ggccagacggcgcagcccgatcggcctatcgccatctacggcgccggtaccgggctgggc
gtcgcgcacctgatccgggccggagatcgctggatcagcctgccgggtgaggggggacac
gtggatttcgcgaccggtagcgatgaagaggacgcgctgctgacggcgctgcgcgccgac
ctggggcgggtctccgccgagcgggtgctctctggccctggtctcgtcaatttgtatcgc
gccgtcgcccgggttgcggggcggacgccgcagtccctgacgccgcaggaggtcagcgag
cgggcgctggccgaccgctgtccggactgtcgacgggcgctgtcgctgttctgtgtgatg
atggggcgctttggtggcaatctggcgctgaatatgggcacctttggcggggtgtatatc
gccggcgggatcgtgccgcgttttctggcgtttttccgcgactccggctttcgtcaggcg
ttcgaggacaaggggcgctttaaggcgtatctcgcgccgatcccggtctttctgatcgtg
cacgacaatcccggtctgcttggcgccggcgcctatctgcgtcagcagctgggcactcat
ctttaa

DBGET integrated database retrieval system