KEGG   Edwardsiella piscicida C07-087: ETAC_05715Help
Entry
ETAC_05715        CDS       T02509                                 

Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00040  Pentose and glucuronate interconversions
etc00052  Galactose metabolism
etc00500  Starch and sucrose metabolism
etc00520  Amino sugar and nucleotide sugar metabolism
etc01100  Metabolic pathways
etc01130  Biosynthesis of antibiotics
Module
etc_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
etc_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ETAC_05715
   00052 Galactose metabolism
    ETAC_05715
   00500 Starch and sucrose metabolism
    ETAC_05715
   00520 Amino sugar and nucleotide sugar metabolism
    ETAC_05715
Enzymes [BR:etc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     ETAC_05715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 PvlArgDC ZirS_C CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AGH73268
Position
1314781..1315635
Genome map
AA seq 284 aa AA seqDB search
MLPATKAIPKEMLPIVDKPLIQKVVHECVQAGVKEIILVTHSSKNAIENHFDTSFELEAL
LEARVKRQLLDEVRSICPPGVTINSVRQHKPLGLGHAILCARPLVGEHPFIVALPDIWLD
TSTFDPASQNLAAMVKRFEESGRSQVLVQPMPLEVLPEYSVINCADAVLEPGQSARMTSI
VEKPEDAEKYQSDLSAVGRYVLSAAIWPILAATGFGAWERIQLSDAIATLLQHRPVEAYR
QVGRSYDCGEKLGYAEAFVAGGLSHSQQGEAFTTWLRDLQTRID
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgctaccggccaccaaggccatcccgaaagagatgctgcccatcgtcgataagccgttg
attcaaaaagtagtacacgaatgtgttcaggcgggggtgaaagagatcatcctggtgacc
cactcctctaagaatgccatcgagaaccacttcgacacctccttcgagttggaggcgctg
cttgaggcgcgcgtcaagcgtcagctgttggatgaggtgcgttccatctgcccgccgggg
gtgactattaacagcgtgcgtcagcataagccgctggggctggggcatgccatcctctgc
gcccgtcctctggtcggggagcatccctttattgtcgcgctgccggatatctggctagac
accagcaccttcgatcccgctagccagaacctggcggcgatggtcaagcgcttcgaagag
agtggccgcagtcaggtcttggtgcagccgatgccgctagaagtgctgccggagtactcg
gtgatcaactgtgccgatgcggtgttggagccggggcagagcgcccgtatgacctcgatt
gtagaaaaacccgaggacgccgagaaataccagtctgacctgtccgcggtcgggcgctat
gttttgtctgctgctatctggccaatcttggccgccaccggctttggcgcctgggagcgc
atccagctctccgatgctatcgccaccctgctgcagcaccgtccggttgaggcctatcgc
caggtcgggcggtcctatgactgcggtgagaaattggggtatgctgaagcctttgtcgcc
ggtgggttgagtcactctcagcagggagaggcctttaccacctggctgcgggatttgcag
acgcgaattgattga

KEGG   Edwardsiella piscicida C07-087: ETAC_07065Help
Entry
ETAC_07065        CDS       T02509                                 

Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase subunit
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00040  Pentose and glucuronate interconversions
etc00052  Galactose metabolism
etc00500  Starch and sucrose metabolism
etc00520  Amino sugar and nucleotide sugar metabolism
etc01100  Metabolic pathways
etc01130  Biosynthesis of antibiotics
Module
etc_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
etc_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ETAC_07065
   00052 Galactose metabolism
    ETAC_07065
   00500 Starch and sucrose metabolism
    ETAC_07065
   00520 Amino sugar and nucleotide sugar metabolism
    ETAC_07065
Enzymes [BR:etc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     ETAC_07065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AGH73534
Position
1608012..1608827
Genome map
AA seq 271 aa AA seqDB search
MLPLVDKPLIQYVVNECIAAGINEIILVTHSSKNSIENHFDTSFELEAILEKRVKRQLLA
EVQAICPKHVTIMQVRQGLAKGLGHAILCAHPLVGDEPFAVILPDVILDEYSADLSSDNL
SEMLRRYESTGASQIMVEPVPMADVSNYGVVDCSGAQLAAGESIAIRAVVEKPPRDKAPS
NLSIVGRYVLSPDIWPLLSKTPPGAGEEIQLTDAIAMLLKNETVEAYHLKGRSHDCGNKL
GYMQAFVEYGLRHPALGKDFAAWIKGLNLSK
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgttgccgctggtagataaaccgctgatccagtacgtggttaatgagtgtattgccgcc
ggtattaatgagatcattttagtcacgcattcatcgaagaactccatcgagaaccacttc
gataccagctttgagctggaggcgatccttgagaagcgcgttaagcgtcagctgctggcc
gaagtccaggccatttgtcctaagcacgtgaccattatgcaggtgcgtcagggactggct
aaaggtttaggtcatgccattctgtgcgctcatccgctggtcggcgatgagccttttgcc
gtgatattgcctgacgttattctggatgaatacagcgcagatttaagcagcgataacctg
agtgagatgctgcgtcgctatgagtccaccggcgccagccagattatggttgagccggtg
ccgatggccgatgtttctaattatggcgtggtggattgcagcggtgcgcaattggctgcg
ggggaaagcattgctattcgcgccgtggttgaaaagccgccgcgcgataaggcgccgtct
aacctgtctatcgttggccgctatgttctctctccggacatttggccgttgctgtctaaa
accccgccgggagccggtgaggaaattcagctgacggatgccattgccatgctgcttaag
aatgaaaccgttgaggcttaccacctgaaagggcgtagccatgactgtggaaataagctg
ggctatatgcaggcgtttgtcgagtatgggctacgtcatcctgcgctgggcaaagatttt
gcagcctggatcaaagggctgaatttaagcaagtaa

DBGET integrated database retrieval system