KEGG   Edwardsiella piscicida C07-087: ETAC_05770Help
Entry
ETAC_05770        CDS       T02509                                 

Definition
(GenBank) 6-phosphogluconate dehydrogenase
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00030  Pentose phosphate pathway
etc00480  Glutathione metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
etc01130  Biosynthesis of antibiotics
etc01200  Carbon metabolism
Module
etc_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
etc_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ETAC_05770
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ETAC_05770
Enzymes [BR:etc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     ETAC_05770
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     ETAC_05770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 6PGD NAD_binding_2 Shikimate_DH F420_oxidored 3HCDH_N NAD_binding_11 2-Hacid_dh_C ApbA NAD_Gly3P_dh_N
Motif
Other DBs
NCBI-ProteinID: AGH73279
Position
1326959..1328374
Genome map
AA seq 471 aa AA seqDB search
MSKQQIGVVGMAVMGRNLALNIESRGYTVSIFNRSPEKTDEVMAQNPGRKLVPYHSVQAF
VASLETPRRILLMVKAGEGTDKTIASLTPYLEPGDILIDGGNTFFQDTIRRSRELSAQGF
NFIGTGVSGGEEGALKGPSIMPGGQKEAYELVAPILRNIAAVAEDGEACVSYIGPDGAGH
YVKMVHNGIEYGDMQLIAEAYSLLKHAVGMSNDDLAATFAEWNRGELSSYLIEITADIFA
KKDDEGNDLVDVILDEAANKGTGKWTSQSALDLGIPLTLITESVFARYLSSLKAQRVAAS
RVLSGPQAQALPAAERAAFAEKVRRALYLGKIVSYAQGFQQLKAASDEYDWALNFGEIAR
IFRAGCIIRAQFLQKITDAYAENPALANLLLAPYFKAIADEYQQALRDVVSYAVQQGIPV
PTLSAAITYYDSYRAAVLPANLIQAQRDYFGAHTYQRTDRDGVFHTEWLAE
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaacaacagatcggtgtagtgggaatggcggtgatggggcgtaacctggcgctg
aacatcgaaagccgcggttatacggtgtcgatttttaaccgttcacccgagaaaaccgat
gaggtgatggcacagaatccggggcggaagctggtgccataccattccgtgcaggcgttt
gtggcctcgctggagacgccgcgccgtattctgctgatggtgaaagcgggtgaggggaca
gacaagaccatcgcctctctgacgccctatctggagccgggggatattctgatcgacggt
gggaataccttcttccaggataccattcgccgcagccgtgagctgtcggcgcagggcttt
aactttatcggtaccggcgtctccggtggcgaggagggtgcgctgaaggggccttccatc
atgccgggcgggcagaaggaggcctacgagctggtggcgccgatcctgcgtaacatcgcc
gccgtcgccgaagatggcgaggcctgtgtgagctacatcgggccggacggcgccgggcac
tatgtgaagatggtgcacaacggtatcgaatatggtgatatgcaactgatcgccgaggct
tactccctgctgaagcatgccgtcggcatgagcaacgacgatctggcggcaaccttcgcc
gagtggaatcgtggtgagctgagcagctacctgatcgagatcaccgccgatatcttcgcc
aagaaagatgacgaagggaatgacctggtcgacgtgatcctggacgaggcggcgaataaa
ggcaccggcaagtggaccagccagagcgcgctggatctggggatcccgctgacgctgatc
accgaatccgtctttgcccgctacctctcctcgctaaaggcgcagcgcgtggcggcctct
cgcgtgctgagtggcccgcaggcgcaggcgctgccggcggctgagcgtgcggcctttgcc
gagaaggtgcgtcgcgccctctatctgggcaagattgtctcctatgcccagggcttccag
cagctgaaggccgcctctgacgaatatgactgggcgctgaactttggcgagatcgcgcgt
atcttccgcgccgggtgcattatccgcgcccagttcctgcagaaaatcaccgatgcctat
gccgaaaatccggcgctggccaacctgttgttggcaccgtacttcaaggcgattgcggat
gagtaccaacaggcgctgcgcgacgtcgtctcctacgccgtacagcaggggatcccggta
ccgaccctctccgcggcgatcacctattacgatagctaccgcgccgcggtgctgccggct
aacctgattcaggcccagcgcgactactttggcgcccacacctaccagcgcaccgatcgg
gacggggtgttccataccgaatggctggcggagtaa

DBGET integrated database retrieval system