KEGG   Edwardsiella piscicida C07-087: ETAC_05790Help
Entry
ETAC_05790        CDS       T02509                                 

Definition
(GenBank) hypothetical protein
  KO
K03760  lipid A ethanolaminephosphotransferase [EC:2.7.8.43]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00540  Lipopolysaccharide biosynthesis
etc01100  Metabolic pathways
etc01503  Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    ETAC_05790
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    ETAC_05790
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:etc01005]
    ETAC_05790
Enzymes [BR:etc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.43  lipid A phosphoethanolamine transferase
     ETAC_05790
Lipopolysaccharide biosynthesis proteins [BR:etc01005]
 Lipid A
  ETAC_05790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EptA_B_N Sulfatase
Motif
Other DBs
NCBI-ProteinID: AGH73283
Position
complement(1334143..1335768)
Genome map
AA seq 541 aa AA seqDB search
MSHKGLSASFLTVILLLAGYFTLILNIPILLHFYRILHALGEYRLGFALSIPVVLFAALT
CVFMPFSFRPILKPFFILLLVITALASYAQYKYQVIFDRSMIENIFETNSAEAGSYLNIY
VIAWVLLAGVLPALLLLRTRIIYGHNVLLRLGIRLLAMLISLLVIALVACLYYQDYASVG
RNNRSLNLEIQPASYLYSTGQYINRRYLTTPMPFRKVGEDAKLVELAGEKPTLVFVILGE
TARAQNQSLGGYARETNPYSAKQPGLIYFRNVTSCGTATAISVPCMFSNLTREHYDGNIA
RNSDSVIDVLHRAGVTTFWRDNDEGCKGACDRTPNELVPTKADNPLCNGKTCYDEVMLNN
LQQKIPDDGKSKLLVFHLIGSHGPTYYLRYPARFRVFMPDCERSDIENCTQQQLVNTYDN
TLVYTDYVVNQFIARLKTYEKQYNVALYYVSDHGESLGEKGLYLHGTPYQFAPAEQTHVP
MSLWLSDGYAKANRINLQCLQEAARDGSFSHDNLFPTLLSMMHVTTSAANPQLDILQRCR
N
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
ttgtcgcataaaggtctttccgccagctttctgacggtcatactgctattggccggttat
tttacgctgatactcaatattcccatcctgctccatttttaccgcatcctgcacgcgctg
ggggagtatcgcctcggcttcgccctgtcgatcccggtggtgctgttcgcggcgttaacc
tgcgtgtttatgccgttcagcttccggccgatcctgaagcccttttttattctgctgctg
gtgatcaccgcgctggccagctacgcccagtacaagtatcaggtgattttcgaccgctcg
atgatcgaaaacatctttgaaaccaacagcgccgaggcgggctcttacctaaatatctat
gttatcgcctgggtgctgctcgccggggtgctgcccgccctgctgctgctgcgcactcgc
atcatctatggccataacgtcctgctgcgactggggatccggctgttggctatgctgatc
tcactgctggtcatcgcgctggttgcctgcctgtactaccaggattacgcctccgtcggg
cgcaacaaccgcagcctgaacctggagatccagcccgccagctacctgtacagcaccgga
caatatatcaaccgccgctacctcacgacgccaatgccgttccgtaaggtgggcgaagac
gcgaagctggttgagctggcgggcgagaagccgacgctggtgttcgtgatcctgggcgaa
accgcccgagcccaaaaccagtctctgggcggctacgcgcgcgaaaccaacccctacagc
gccaaacagcctgggctcatctacttccgcaatgtcacctcttgcggcacggcgaccgcg
atttcggtcccctgcatgttctccaacctgacgcgtgagcactatgatggcaacatcgcg
cgcaacagcgacagcgtgatcgatgtgctacaccgggccggcgtcaccaccttctggcgt
gataacgacgagggctgcaaaggcgcatgcgatcgcacgccgaacgagctggtgccgacc
aaggccgataatccgctgtgcaacggcaagacctgctatgacgaggtcatgttgaataac
ctgcagcaaaagatcccggacgacggcaaaagcaagctgctggtgttccatctgatcggc
agccacggcccgacctactatctgcgctatcccgcgcgcttccgcgtctttatgcccgac
tgcgagcgcagcgatattgaaaactgcacccagcagcagctggtcaacacctatgacaat
accctggtgtataccgactacgtggtgaatcagtttattgcgcggctgaaaacctacgag
aagcagtacaacgtggcgctgtactatgtctccgaccacggtgagtcactgggcgagaaa
gggctgtatctgcacggcaccccttatcagttcgccccggcagagcagacccatgtcccg
atgtcgctgtggctgtcggacggctatgccaaggccaatcgcatcaatctgcagtgtctg
caggaggccgcccgtgacggcagcttctcccatgacaatctcttccctaccctgctttct
atgatgcatgtcactaccagcgcggcaaatccacagttggatattctgcaacgctgccgt
aactga

DBGET integrated database retrieval system