KEGG   Edwardsiella piscicida C07-087: ETAC_05815Help
Entry
ETAC_05815        CDS       T02509                                 

Definition
(GenBank) Negative regulator of flagellin synthesis FlgM
  KO
K02398  negative regulator of flagellin synthesis FlgM
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
etc02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_05815
 09140 Cellular Processes
  09142 Cell motility
   02040 Flagellar assembly
    ETAC_05815
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:etc02035]
    ETAC_05815
Bacterial motility proteins [BR:etc02035]
 Flagellar system
  Flagellar assembly proteins
   Regulation
    ETAC_05815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FlgM DUF775
Motif
Other DBs
NCBI-ProteinID: AGH73288
Position
complement(1340192..1340488)
Genome map
AA seq 98 aa AA seqDB search
MSIDRTSALSAISHLQAREPQDAAQQTRKIATSQESVVGTQVKLSDAQARLMQPNSRDIN
TTRVEALKQAIRSGELKMDTGKIADALLQDTFAYLKDK
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
atgagcatagatcgtacctccgcactgagtgccatcagccaccttcaggcccgggagccg
caggatgcggcgcagcagacccgcaagatagcgaccagccaagagagcgttgtcggtacc
caggtcaagctgagcgacgcacaggcacgcctgatgcagcccaacagccgcgacatcaac
accacccgtgttgaggcgctgaaacaggctatccgcagcggtgaactgaagatggatacc
ggcaaaatcgccgatgccttactgcaggatacgttcgcctatttaaaggataagtaa

DBGET integrated database retrieval system