KEGG   Edwardsiella piscicida C07-087: ETAC_05880Help
Entry
ETAC_05880        CDS       T02509                                 

Definition
(GenBank) aspartate/tyrosine/aromatic aminotransferase
  KO
K00813  aspartate aminotransferase [EC:2.6.1.1]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00220  Arginine biosynthesis
etc00250  Alanine, aspartate and glutamate metabolism
etc00270  Cysteine and methionine metabolism
etc00330  Arginine and proline metabolism
etc00350  Tyrosine metabolism
etc00360  Phenylalanine metabolism
etc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
etc00401  Novobiocin biosynthesis
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01130  Biosynthesis of antibiotics
etc01210  2-Oxocarboxylic acid metabolism
etc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ETAC_05880
   00270 Cysteine and methionine metabolism
    ETAC_05880
   00220 Arginine biosynthesis
    ETAC_05880
   00330 Arginine and proline metabolism
    ETAC_05880
   00350 Tyrosine metabolism
    ETAC_05880
   00360 Phenylalanine metabolism
    ETAC_05880
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ETAC_05880
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    ETAC_05880
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:etc01007]
    ETAC_05880
Enzymes [BR:etc01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     ETAC_05880
Amino acid related enzymes [BR:etc01007]
 Aminotransferase (transaminase)
  Class I
   ETAC_05880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AGH73301
Position
complement(1352067..1353260)
Genome map
AA seq 397 aa AA seqDB search
MFENIPAAPADPILGLADLFRADARPHKINLGIGVYKDESGNTPVLTSVKKAEQYLLEHE
TSKNYLSIDGIAAFGQRTLELLLGSDSPIIGAGRALAAQTPGGTGALRVAADFLASKTCA
KRIWVSNPSWPNHRSVFSAAGLEVCEYAYYDADNHCLDFAALQESLSQAQPGDVVLFHGC
CHNPTGIDPTTAQWEALAEMSRRNGWLPLFDFAYQGFAHGLEEDAQGLRLFAARHDELIV
CSSYSKNFGLYNERVGACTLIAADSNSATNAFSQIKAVIRANYSNPPAHGGAIVATILGN
DALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGADRDFSFIIHQNGMFSFSGLTKEQVGR
LRDEFGVYAVSSGRINVAGMTPDNMAPLCEAIVAVLK
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaaaacatccctgctgcacccgccgatccaatcctggggctggccgacctgttt
cgcgccgatgcgcgcccgcataaaatcaacctgggcatcggcgtctataaagacgaaagc
ggtaatacgccggtgctgaccagcgttaaaaaggccgagcagtacctgctggagcatgag
accagcaagaactacctgagcatcgacgggatcgccgccttcggccagcgaaccctggag
ctgctgctgggcagcgacagcccgattatcggcgccgggcgagcgctcgcggcgcagacg
cccggcggcaccggggcgctgcgcgtcgccgccgacttcctggccagtaaaacctgtgcc
aaacgtatctgggtgagcaaccccagctggccgaaccaccgcagcgtcttcagcgccgcc
ggactggaggtgtgcgaatacgcctactatgacgccgataaccactgcctggactttgcc
gccctgcaggagagcctctctcaggcacagcctggcgacgtggtgctgttccacggctgt
tgccataacccgacggggattgacccgaccacggcgcagtgggaggccctggcggagatg
tcgcgtcgcaatggctggctaccgctgttcgacttcgcctatcagggctttgcccatgga
ctggaagaggacgcgcaggggctacgcctctttgcggcccgtcacgacgagctgatcgtc
tgcagctcctactccaagaactttggtctgtacaacgagcgcgttggcgcctgtaccctg
atcgccgccgatagcaacagtgccaccaacgccttcagccagatcaaggcggtgatccgc
gccaactactccaacccgccggcccacggcggcgctatcgtcgccaccattctgggcaac
gacgcgctgcgcgccatttgggagcaggagctgaccgatatgcgccagcgtatccagcgg
atgcgtcagctgttcgtgaataccctgcaggagaaaggcgccgatcgggactttagcttt
atcatccatcaaaacggtatgttctccttcagcgggctgaccaaagagcaggtaggccgt
ctgcgcgacgagttcggcgtctacgccgtcagctccgggcgcatcaacgtggcggggatg
acgccggacaatatggcgccgctgtgcgaagccatcgttgccgtactgaaataa

DBGET integrated database retrieval system