KEGG   Edwardsiella piscicida C07-087: ETAC_06110Help
Entry
ETAC_06110        CDS       T02509                                 

Definition
(GenBank) hypothetical protein
  KO
K07783  MFS transporter, OPA family, sugar phosphate sensor protein UhpC
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_06110
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_06110
Transporters [BR:etc02000]
 Major Facilitator Superfamily (MFS)
  Phosphate and organophosphate transporters
   Organophosphate:Pi antiporter (OPA) family [TC:2.A.1.4]
    ETAC_06110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1
Motif
Other DBs
NCBI-ProteinID: AGH73347
Position
complement(1403546..1404835)
Genome map
AA seq 429 aa AA seqDB search
MNNIDKIYKQLRWQIIITTFLTYTVMYISRKAFAAAAPLLMQDIGMTAVQFGTASSIYYI
LYGISKFSSGLLADRINPRLFLAPVLLVIAVINVGIGMSNNVTVLLSLYCLTAVAQGCGF
PPIAKAISQWYSKSERGGWYSLWNTSHNVGGALAPLIASGVIEYTGNWRYAFYVPAAITA
VQAIISAIFMRAKPEKYGLPNVGEWKKDTKQLAINQRSEGGLTMWAMFTRYIVNNPIIWM
AIGGDLCIYVIRTVTNDWVSVYFVKELGWDLVKSNSLVAWFEVGGILGGLTSGIISDRLF
NADRWKTILIYSFVLIAGMIGVALTIHVHYYLVAICFFIIGAGIYAPQMLFALGIIEASH
ADGAGAATGLKGGVTYIGAAMAGAPIALIEKAYSWNGVFILLAAIAILLVLLTIGIIGVD
KRYNRINAR
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaataatatagataaaatctataaacaattacgctggcaaattatcatcacgacattc
ctaacgtataccgtgatgtatatttcacgaaaagcatttgccgcagcggcgccactgctg
atgcaggatattggcatgaccgcagtacaattcggtactgcctcctctatttattatatt
ttatatggtatttcgaagttcagctccgggctattggcggatagaattaacccgcgcctt
tttctagccccggtgctgctggtcatcgccgtgatcaacgtcggtatcggcatgtccaat
aacgttaccgtgctgctatcgctctactgcctgaccgccgtagcccagggctgtggcttc
cctcccatcgcgaaggccatcagccagtggtactctaaatcagagcgcggcggctggtat
tcactgtggaatacctcccacaacgttggcggtgcgctggctccgctcatcgcctccggc
gttattgaatataccggaaactggcgctatgccttctatgttccagccgccattaccgcc
gtccaggcgattatctccgcgatatttatgcgcgccaagccggaaaaatatggcctgccc
aacgtgggcgaatggaagaaagacaccaagcagttggccatcaatcaacgctctgaaggc
ggcctcaccatgtgggccatgtttacccgctacatcgtcaacaacccgattatctggatg
gccatcggtggggatctgtgcatttacgtcatccgcaccgtgaccaatgactgggtcagc
gtctactttgtcaaagagctgggctgggatctggtaaaatccaactcgctggtcgcctgg
tttgaggtcggcggcatcctcgggggactgacctccggcatcatttcggatcgactgttt
aacgccgatcgctggaaaaccattctaatctatagcttcgtcctgatcgccggcatgatt
ggcgtcgcgctgacgatccacgtccactattacctggtcgccatctgcttctttatcatc
ggcgcagggatctatgccccccaaatgctgttcgcgctggggatcatcgaggcctcccat
gccgacggcgccggggcggcaaccggcctgaaaggcggcgtgacctacattggtgcagcg
atggctggggcgcctatcgcgctgatcgagaaagcctactcctggaatggggtctttatc
ctgctggcggccatcgccattcttctggtgctgctaaccattggcatcatcggcgtggat
aaacgttacaatcgtatcaacgcacgctaa

KEGG   Edwardsiella piscicida C07-087: ETAC_06285Help
Entry
ETAC_06285        CDS       T02509                                 

Definition
(GenBank) Hexose phosphate uptake regulatory protein UhpC
  KO
K07783  MFS transporter, OPA family, sugar phosphate sensor protein UhpC
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_06285
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_06285
Transporters [BR:etc02000]
 Major Facilitator Superfamily (MFS)
  Phosphate and organophosphate transporters
   Organophosphate:Pi antiporter (OPA) family [TC:2.A.1.4]
    ETAC_06285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1
Motif
Other DBs
NCBI-ProteinID: AGH73380
Position
complement(1443516..1444751)
Genome map
AA seq 411 aa AA seqDB search
MALGYAAFYLTRKSVNYVLPALQTDLGLDKGSIGLLGSLFYLTYGLSKFAAGLWHDSHGQ
RAFMGMGLFATGALNVAFAFTQSLPLMLVIWTLNGFFQGWGWPPCARLLTHWYSRNERGF
WWGSWNMSINLGGALMPLICAYAALRWGWQAAMLTPGIIGMILGIWLIMQLTGTPRELGL
PSVGVWRNDPLELRQERQSPPMGLWQMLRTTVLKNPMIWLLGIAYVLVYLIRIALNDWGN
IWLTESHGVNLLSANATVMLFEVGGLLGALFAGWGSDLLFRGQRAPMILLFTLGLMVSVS
ALWLVQVHHYALLAVCFFSVGFFVFGPQMLIGLAAVECGHKDAAGSITGFLGLFAYLGAA
LAGWPLSQIIERYGWSGMFSLLSIAAVLMVLLLMPLLMAGVTLSLGQRIKQ
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgggctacgccgcgttttacctgacgcgcaaaagcgtgaactacgtccttcct
gcgctgcaaacggatctcggactggacaaaggcagcatcggcctgctggggtcactgttt
tacctcacctatggcctgtccaagtttgccgccgggctctggcacgatagccatggtcag
cgggcgtttatgggcatgggcctgtttgccaccggcgcgctgaacgtggcgttcgccttt
acccagtcgctgccgctgatgctggtgatctggacgctgaacggcttctttcaggggtgg
ggatggcctccctgcgcccggctgctcacccactggtactcgcgcaacgagcgcggtttc
tggtggggcagctggaatatgtccatcaatctcggcggcgcgctgatgccgctgatctgc
gcctacgccgccctgcgctgggggtggcaggccgccatgctgaccccggggatcatcggt
atgatcctggggatctggctgataatgcagttaacgggaacgccgcgggagctggggctg
ccctccgtcggcgtctggcgtaacgatccgctagagctgcgccaggaacggcaaagtccg
cccatggggctgtggcaaatgctgcgcaccaccgtgctgaagaaccccatgatctggctg
ctgggcatcgcctatgtgttggtctacctgatccgtattgcgctcaacgactggggcaac
atctggctgaccgaaagccacggcgtcaatctgctcagcgccaacgccacggtgatgctg
tttgaggtcggcggcctgctgggggcactgtttgccggctggggatcggatctgctgttc
cgcggacagcgggcgcccatgatcctgctgttcacgctcgggctgatggtctccgtgagc
gcgctgtggctggtccaggttcaccactatgcgctgctcgccgtctgcttcttttccgtg
ggcttctttgtctttggtccgcagatgctgatcggcctcgccgccgtcgaatgcggtcac
aaggatgccgcgggatccattacgggatttctcggcctgttcgcgtatctgggcgccgcg
ctggcaggctggccgctgtcacagattatcgaacgctacggctggtcggggatgtttagc
ctgctctccatcgccgccgtactgatggtgctgttgctgatgccgctgctgatggcgggc
gtcaccctctctcttggccaaaggataaaacaatga

KEGG   Edwardsiella piscicida C07-087: ETAC_16200Help
Entry
ETAC_16200        CDS       T02509                                 

Definition
(GenBank) regulatory protein UhpC
  KO
K07783  MFS transporter, OPA family, sugar phosphate sensor protein UhpC
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_16200
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_16200
Transporters [BR:etc02000]
 Major Facilitator Superfamily (MFS)
  Phosphate and organophosphate transporters
   Organophosphate:Pi antiporter (OPA) family [TC:2.A.1.4]
    ETAC_16200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 ARL6IP6
Motif
Other DBs
NCBI-ProteinID: AGH75361
Position
complement(3668809..3670155)
Genome map
AA seq 448 aa AA seqDB search
MWSFLKSRTDAPEIQDSAKVDAAYKYWRIQLMWVMYVGYAAFYFTRKSFNFIMPEMISDL
GLSMSDIGIMGTLFYITYGCSKFISGMISDRSNPRYFMGLGLIMTGIINIVFGMSSSLLV
LGALWMVNAFFQGWGWPPCSKILTSWYSRAERGSWWAIWNTSHNVGGALIPLLVGFISLH
FSWRYGMIIPGIIGIVLGLLMCWRLRDKPITMGLPSVGKWRNDALELVQESEGKGLSNKE
IIKRYVLTNKYIWLLAVSYVLVYIVRTAINDWGNLYLTQTKGYSLMTANSALSLFEVGGF
IGSLVAGWGSDRLFRGNRGPMNLIFAIGIFLSVAALWLMPGGSYALQAACFFSIGFFIFG
PQMLIGMAAAECSHKDAAGAATGFVGLFAYLGAALSGYPIARVMEVWHWNGFFVVISVAA
CLSALFLLPFLRAQKADSKAPPAVQANA
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgtggtcttttctgaaaagccgcaccgacgcgcccgagatccaggatagcgccaaggtt
gatgcagcctataaatactggcgcatccagctgatgtgggtcatgtatgttggctacgcc
gccttttactttacccgcaaaagcttcaacttcatcatgccggaaatgatcagcgatctg
gggctgagcatgtccgatatcggcatcatgggtacgctgttctatatcacctatggctgc
tccaagttcatctccgggatgatcagcgatcgctctaacccgcgctattttatggggctg
gggctgatcatgaccggtattatcaatatcgtcttcgggatgagttcgtcgctgctggtg
ctgggagcgctgtggatggttaacgccttcttccagggctggggctggccgccgtgctcg
aagatcctgaccagctggtattcacgcgccgaacgcggcagctggtgggccatctggaat
acctctcataacgtcggcggcgcgctgatcccgctgctggtcggctttatctctctgcac
ttcagctggcgctatggcatgatcatccccgggattatcggcatcgttctggggctgctg
atgtgctggcgcctgcgcgacaagccgatcacgatggggctgccgagcgtcggcaaatgg
cgtaatgacgccctggagctggtgcaggagtccgaaggcaaagggctctccaataaagag
atcatcaagcgctatgtgctgacaaataagtacatctggctgctggccgtctcttatgta
ctggtatatatcgtacgtaccgcgatcaatgactggggtaacctgtacctgacccagacc
aagggctactcgctgatgaccgccaactcggcgctgtcgctgtttgaggtggggggcttt
atcggttccctggtcgccggctggggttccgataggctgttccgcggcaaccgtggtccc
atgaacctgatcttcgctatcgggatcttcctctccgtggccgcgctgtggctgatgccg
ggcggcagctatgcgctgcaggccgcctgtttcttctccatcggcttcttcatctttggc
ccgcagatgctgatcgggatggccgccgccgagtgttcccataaggatgcggccggcgca
gcgaccggctttgtcggcctgttcgcctatctgggggcggcgctttccggttatccgatc
gcgcgggtgatggaagtgtggcactggaacggctttttcgtcgtgatttccgtggccgcc
tgtctgtctgcgctgtttctgctgccgttcctgcgtgcgcagaaggccgatagcaaagcg
ccgccggcggtgcaggctaacgcctga

DBGET integrated database retrieval system