KEGG   Edwardsiella piscicida C07-087: ETAC_06120Help
Entry
ETAC_06120        CDS       T02509                                 

Definition
(GenBank) UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase
  KO
K07806  UDP-4-amino-4-deoxy-L-arabinose-oxoglutarate aminotransferase [EC:2.6.1.87]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00520  Amino sugar and nucleotide sugar metabolism
etc01100  Metabolic pathways
etc01503  Cationic antimicrobial peptide (CAMP) resistance
etc02020  Two-component system
Module
etc_M00721  Cationic antimicrobial peptide (CAMP) resistance, arnBCADTEF operon
etc_M00761  Undecaprenylphosphate alpha-L-Ara4N biosynthesis, UDP-GlcA => undecaprenyl phosphate alpha-L-Ara4N
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    ETAC_06120
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_06120
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    ETAC_06120
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:etc01005]
    ETAC_06120
   01007 Amino acid related enzymes [BR:etc01007]
    ETAC_06120
Enzymes [BR:etc01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.87  UDP-4-amino-4-deoxy-L-arabinose aminotransferase
     ETAC_06120
Lipopolysaccharide biosynthesis proteins [BR:etc01005]
 Unusual sugar
  ETAC_06120
Amino acid related enzymes [BR:etc01007]
 Aminotransferase (transaminase)
  Others
   ETAC_06120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DegT_DnrJ_EryC1 Aminotran_1_2 Cys_Met_Meta_PP Aminotran_5 Beta_elim_lyase SepSecS OKR_DC_1
Motif
Other DBs
NCBI-ProteinID: AGH73349
Position
1407457..1408602
Genome map
AA seq 381 aa AA seqDB search
MKDFLPFSKPAIGEEEIAAVSEVLRSGWITTGPQNQALEQEFCQAIGARHAIAVCSATAG
MHVTLMALGIGPGDEVITPSMTWVSTLNIITLLGATPVMIDVDRDTLMVTPEAIAEAITP
RTKAIIPVHFAGAPVDLDPIRALAQRHGIALIEDAAHAIGTAYRGEPIGQRGTAIFSFHA
IKNVTCAEGGMVVTDDDALAQKMRSLKFHGLGVDAYDRQTHGRAPQAEVVTPGYKYNLAD
INAAIARVQLAKLPELNAQRARLAAYYLQQLALHQLPFTPLSAPDWPHQHAWHLFIIRCD
EAHCGVDRDRLMQALKERNIGSGLHFRAAHTQKYYRETYPQLRLAQTEWNSQRICSLPLF
PDMTEADVDRVIGALKEIIEQ
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaaggactttttgccattctccaagccagctatcggcgaggaggagattgctgcagtc
agtgaagtgctgcgctccggctggatcacgaccggtccgcaaaatcaggcgttggagcaa
gagttctgccaggctatcggcgcccgtcatgctatcgccgtgtgctccgcgacggcggga
atgcacgttaccctgatggcgctgggcattgggccgggggatgaagtgataaccccgtca
atgacctgggtgtccaccctgaatatcatcacgctgctgggggcgacccccgtgatgatc
gatgtcgatcgcgatacgctgatggtgacgccagaggctattgccgaggcgataacgccg
cgcaccaaggcgattattcccgtccatttcgccggcgcccccgtcgatcttgacccgatc
cgcgcgctggcgcagcggcacggcattgccctgatcgaagacgcggcccatgccattggc
accgcctaccgcggtgagcctatcggccaacgcggcaccgccattttctcgtttcatgcg
atcaaaaacgtcacctgtgccgagggtggcatggtggtgaccgatgatgatgctctggcg
cagaagatgcgcagtctgaagtttcacggtctgggcgtggatgcctacgatcgccagacc
catggccgggcgccgcaggcagaggtggtgacgccgggatacaagtacaacttggccgac
atcaacgcggcgatagcccgggtgcagctggcaaaactgcctgagctcaacgcccagcgc
gcccggctggcggcctattatctgcagcagttggcgctgcatcagctgccgttcactccg
ctgagcgcgcccgactggccgcatcagcatgcttggcacctgtttatcatccgttgcgac
gaggcccactgcggcgtggatcgcgatcggctgatgcaggcgctcaaagagcgcaacatc
ggcagcgggctgcactttcgcgccgcccacacgcaaaaatattaccgtgagacctatcca
cagctacgtctggcgcagacggagtggaattcacagcgtatctgttccctgccgctgttt
ccggatatgaccgaggcagacgtagatcgggtgatcggcgcgttgaaagagattattgag
cagtaa

DBGET integrated database retrieval system