KEGG   Edwardsiella piscicida C07-087: ETAC_06125Help
Entry
ETAC_06125        CDS       T02509                                 

Definition
(GenBank) Polymyxin resistance protein ArnC, glycosyl transferase
  KO
K10012  undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase [EC:2.4.2.53]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00520  Amino sugar and nucleotide sugar metabolism
etc01100  Metabolic pathways
etc01503  Cationic antimicrobial peptide (CAMP) resistance
Module
etc_M00721  Cationic antimicrobial peptide (CAMP) resistance, arnBCADTEF operon
etc_M00761  Undecaprenylphosphate alpha-L-Ara4N biosynthesis, UDP-GlcA => undecaprenyl phosphate alpha-L-Ara4N
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    ETAC_06125
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    ETAC_06125
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:etc01005]
    ETAC_06125
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_06125
Enzymes [BR:etc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.53  undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase
     ETAC_06125
Lipopolysaccharide biosynthesis proteins [BR:etc01005]
 Unusual sugar
  ETAC_06125
Transporters [BR:etc02000]
 Other Transporters
  Others
   ETAC_06125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_3 Glyco_tranf_2_2 Glyco_tranf_2_4 Glyco_transf_21
Motif
Other DBs
NCBI-ProteinID: AGH73350
Position
1408618..1409595
Genome map
AA seq 325 aa AA seqDB search
MSDFKTIQFVSVVIPVYNEQESLPELLKRTIAACDATGKQYEIVLVDDGSSDRSAEILRE
AAQRPGSRVVAVLLNRNYGQHSAIMAGFSHIKGDLVITLDADLQNPPEEIPRLVETADQG
YDVVGTIRQNRQDSWFRKRASRMINGLIQRTTGKSMSDYGCMLRAYRSSIIKAMLHCHER
STFIPILANSFARRTIEIPVKHAEREHGESKYGLMKLINLMYDLVTCLTTTPLRALSIFG
SVIALLGFAFAVLLILMRLTLGPQWAAEGVFTLFAVLFIFIGAQFVGMGLLGEYIGRIYN
DVRARPRYFIQNVVRANPPDEEQEK
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgagtgattttaaaaccatccagtttgtatcggtggtgataccggtttacaacgagcag
gagagcctgccggagctgttgaaaaggaccatcgccgcctgcgatgccacgggaaaacag
tatgagatagtcctggtggacgacggcagcagcgatagatcggccgagatcctccgcgag
gcggcgcagcgcccggggagccgggtagtcgcggtgttgctgaaccgtaactatggtcaa
cattcggcgattatggccggattcagccacattaaaggcgatctggtgatcacgctggat
gccgacctgcagaatccgccggaggagattccgcgtctggtggagaccgccgatcagggc
tatgacgtggtgggcaccattcgccagaaccgtcaggatagctggttccgtaagcgcgcc
tcgcgcatgatcaatggcctgatccagcgcaccaccggcaagagcatgagcgactatggc
tgcatgctgcgcgcctaccgcagcagcatcatcaaggccatgctgcactgccatgagcgc
agcacctttatccccattctggccaacagctttgcccgtcgcaccatcgagatcccggtg
aaacacgccgagcgtgagcacggcgagtccaagtatgggctgatgaagctgatcaatctg
atgtacgacctggtgacctgcctgaccacgaccccgctgagggcgctgagcatttttggc
agcgttatcgcgctgctgggcttcgcctttgccgtactgctgatcctgatgcgtttaacc
cttggaccacagtgggctgcggaaggggtatttaccctgtttgccgtgctgttcatcttt
atcggcgcgcagtttgttgggatgggcctgctgggtgagtacatcggccgcatctataac
gacgtgcgcgcccgtccccgctattttattcagaatgtcgttcgcgctaacccgccggac
gaagaacaggaaaaatga

DBGET integrated database retrieval system