KEGG   Edwardsiella piscicida C07-087: ETAC_06130Help
Entry
ETAC_06130        CDS       T02509                                 

Definition
(GenBank) bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase
  KO
K10011  UDP-4-amino-4-deoxy-L-arabinose formyltransferase / UDP-glucuronic acid dehydrogenase (UDP-4-keto-hexauronic acid decarboxylating) [EC:2.1.2.13 1.1.1.305]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00520  Amino sugar and nucleotide sugar metabolism
etc01100  Metabolic pathways
etc01503  Cationic antimicrobial peptide (CAMP) resistance
Module
etc_M00721  Cationic antimicrobial peptide (CAMP) resistance, arnBCADTEF operon
etc_M00761  Undecaprenylphosphate alpha-L-Ara4N biosynthesis, UDP-GlcA => undecaprenyl phosphate alpha-L-Ara4N
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    ETAC_06130
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    ETAC_06130
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:etc01005]
    ETAC_06130
Enzymes [BR:etc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.305  UDP-glucuronic acid dehydrogenase (UDP-4-keto-hexauronic acid decarboxylating)
     ETAC_06130
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.13  UDP-4-amino-4-deoxy-L-arabinose formyltransferase
     ETAC_06130
Lipopolysaccharide biosynthesis proteins [BR:etc01005]
 Unusual sugar
  ETAC_06130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd Formyl_trans_N Formyl_trans_C NAD_binding_10 3Beta_HSD TrkA_N Sacchrp_dh_NADP RmlD_sub_bind
Motif
Other DBs
NCBI-ProteinID: AGH73351
Position
1409598..1411577
Genome map
AA seq 659 aa AA seqDB search
MKAVVFAYHDMGCAGVQSLIDAGYEIAAIVTHQDAPGENLFFGSVARLAAQHNIPVFAPD
DVNHPLWVERLRALQPQVIFSFYYRHLLSDAILTLAPQGAFNLHGSLLPAYRGRAPLNWV
LVNGETETGVTLHRMETRADAGNIIAQRRIAIAEEDTALTLHHKLCQCARALLAEALPQI
RGGSYAEFPQDESAATYVGRRTPADGRLEWSKPARALYNLVRAVTEPWPGAFSYAGNRQF
TVWQARVRSDLPAARPGTVLSASPLTIACGDGALEIVAGQPQDGLYMQGSQLAESLGLVE
GAILNSSLNFGARRATRVLILGVNGFIGNHLTERLLAEDNYEVYGLDIGSDAISRFIDHP
RFHFVEGDISIHSEWIEYHIKKCDVVLPLVAIATPIEYTRNPLRVFELDFEENLKIVRDC
VKYKKRIIFPSTSEVYGMCSDPQFDEDSSNLIVGPINKQRWIYSVSKQLLDRIIWAYGAK
DELRFTLFRPFNWMGPRLDNLNAARIGSSRAITQLILNLVEGSPIKLVDGGRQKRCFTDI
KEGVEALFRIIENKDNLCDGQIINIGNPDNEASIRELAEQLLVCFEQHPLRDRFPPFAGF
REVESSSYYGKGYQDVEHRKPSIRNAQRLLGWQPVIPMESTIEDTLDFFLQTFDGTEQE
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgttgtttttgcctatcacgatatgggttgtgccggtgtgcagtcattgatt
gatgctggttatgaaatcgctgccattgttactcaccaggatgctcccggtgaaaatctg
ttctttggctcggtcgctcgccttgcggcccagcataatattccggtgtttgcgccggat
gatgtgaatcacccgctgtgggttgagcgtctgcgggcgctgcagccgcaggtgatcttc
tccttctactatcgccatctgctgagcgacgcgattttaacgctggcgccgcagggcgcg
tttaacctgcatggttcgctgttgccggcctaccgtggccgtgccccgctgaactgggtg
ctggtcaacggcgagacggagaccggggtgacgctgcaccgtatggagacgcgtgcggat
gctgggaatattatcgctcagcgccgtatcgcgattgccgaagaggacacggcgctgacg
ctgcaccacaaactgtgccagtgcgcccgcgcgctgctggccgaggcgctgccgcagatc
cgcggcggcagctacgcagagttcccgcaggatgaaagcgccgccacctacgttggccgc
cgtacgccggccgatggccgcctggagtggagtaaaccggcgcgggcgctgtataacctg
gttcgcgcggtgacggagccgtggccgggcgcctttagctatgccggcaaccgtcagttt
acggtctggcaggcgcgggtgcgcagcgatctgcctgccgcgcgtcccggtacagtgctg
tcggcgtcgccgctgacgatcgcctgtggcgacggggcgttggagatcgtggccggtcag
ccgcaggatggcctgtatatgcagggcagccaactggcggaaagcctgggactggttgag
ggcgcgatcctgaacagctcgctgaactttggcgcccgtcgggcgacccgcgtgctgatc
ctgggggttaacggctttatcggtaaccatttgaccgagcgtctgctggcggaagataac
tatgaagtctacggcctggacatcggctctgacgccatctcccgttttatcgaccacccg
cgcttccactttgtggaaggggatatcagcattcactccgaatggatcgagtatcacatt
aagaagtgtgacgtggtgctgccgctggtggcgattgcaacgccgatcgaatatacccgt
aatccgctgcgcgtttttgagctcgactttgaagagaacctgaagattgtgcgcgactgc
gtgaaatacaaaaagcgcatcatcttcccgtccacctctgaagtctacgggatgtgcagc
gatcctcagtttgatgaggatagctctaacctgatcgtcgggccgatcaacaaacagcgc
tggatctactccgtatccaagcagctgctggatcgcatcatctgggcctacggcgccaag
gatgaactgcgtttcacgctgttccgccccttcaactggatggggccgcgtctggacaac
ctgaatgcggcgcgtatcggcagctcgcgcgccattacccagctgatcctaaacctggtg
gaagggtcgccgatcaagctggtggacggcggacgtcagaagcgttgctttaccgacatt
aaagaaggggtggaagcgctgttccgcattatcgaaaacaaagacaatctgtgcgatgga
cagattatcaacatcggtaacccggataacgaagccagcattcgtgagctggctgagcag
ctgctggtgtgctttgagcagcatccgctgcgcgatcgcttcccgccctttgccggcttc
cgcgaggtggagagcagcagctactatggcaaaggctaccaggacgtagagcaccgtaaa
ccgagcatccgcaacgcacagcgcctgctgggttggcagccggtgatcccgatggagagc
actatcgaggatactctggacttcttcctgcagacctttgacggtacggagcaggaatga

DBGET integrated database retrieval system