KEGG   Edwardsiella piscicida C07-087: ETAC_06135Help
Entry
ETAC_06135        CDS       T02509                                 

Definition
(GenBank) 4-deoxy-4-formamido-L-arabinose-phosphoundecaprenol deformylase ArnD
  KO
K13014  undecaprenyl phosphate-alpha-L-ara4FN deformylase [EC:3.5.1.-]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00520  Amino sugar and nucleotide sugar metabolism
etc01100  Metabolic pathways
etc01503  Cationic antimicrobial peptide (CAMP) resistance
Module
etc_M00721  Cationic antimicrobial peptide (CAMP) resistance, arnBCADTEF operon
etc_M00761  Undecaprenylphosphate alpha-L-Ara4N biosynthesis, UDP-GlcA => undecaprenyl phosphate alpha-L-Ara4N
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    ETAC_06135
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    ETAC_06135
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:etc01005]
    ETAC_06135
Enzymes [BR:etc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.-  
     ETAC_06135
Lipopolysaccharide biosynthesis proteins [BR:etc01005]
 Unusual sugar
  ETAC_06135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Polysacc_deac_1
Motif
Other DBs
NCBI-ProteinID: AGH73352
Position
1411574..1412473
Genome map
AA seq 299 aa AA seqDB search
MKRVGLRIDVDTWRGTRDGVPALVSLLRRHGIRATFFFTLGPDNMGRHLWRLLKPRFLWK
MLRSNAASLYGWDILLAGTAWPGRRIGAGLADTIAAAAKEHETGLHAWDHHAWQAWAGVW
SREKMAEQIGLAYDELQLITGESIDCSAVAGWRADARVVEAKEPFGFRYNSDCRGTHPFR
PLLPDGRLGTVQIPVTQPTWDEAIGVMTDEAGFNRFILDSILADRGVPVYTIHAEVEGIA
KHAQFARLLEMAREAQIEFCPLGDLLPDDITLLPSGRVVRTTLTGREGWLGCQQEVESP
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgggtcggtctgcgcattgacgtagacacctggcgcggcacgcgtgacggcgtg
ccggcgctggtgtcgctgctgcgccggcacgggatccgggcgacgttcttttttaccctg
ggtccggacaatatggggcgccacctgtggcgcctgctgaagccgcgctttctgtggaaa
atgctgcgctctaacgccgcatcgctgtatggctgggatatcttgctggccgggacggcc
tggcccggacgccggatcggtgccggcctggccgacaccatcgccgccgccgcgaaagag
catgagaccgggcttcacgcctgggatcaccatgcctggcaggcctgggccggcgtttgg
tcacgggagaagatggccgagcagatcgggctggcctacgatgagctgcagctgatcacc
ggggagagtatcgattgctccgcggttgccggctggcgcgccgatgcacgggtggtcgag
gccaaggagccctttggctttcgctataacagcgattgtcgcggtacgcatccgtttcgt
ccgctgctgccggatggccgcctggggacggtgcagatcccggtgacccagcccacctgg
gatgaggccatcggcgtcatgaccgatgaggcgggatttaaccgcttcattctcgacagc
atcctggccgatcgcggcgtcccggtttacaccatccacgccgaagttgaaggcattgcc
aaacatgcgcagtttgcccgcctgctggagatggcgcgcgaggcacagattgaattttgc
ccccttggggatttattgccagacgatattacgctgttgccgagcgggcgagtcgtccgc
acgacgttgaccgggcgtgagggatggctgggttgtcagcaggaggtggagtcgccatga

DBGET integrated database retrieval system