KEGG   Edwardsiella piscicida C07-087: ETAC_06140Help
Entry
ETAC_06140        CDS       T02509                                 

Gene name
arnT
Definition
(GenBank) 4-amino-4-deoxy-L-arabinose transferase
  KO
K07264  4-amino-4-deoxy-L-arabinose transferase [EC:2.4.2.43]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00540  Lipopolysaccharide biosynthesis
etc01503  Cationic antimicrobial peptide (CAMP) resistance
Module
etc_M00721  Cationic antimicrobial peptide (CAMP) resistance, arnBCADTEF operon
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    ETAC_06140 (arnT)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    ETAC_06140 (arnT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:etc01003]
    ETAC_06140 (arnT)
   01005 Lipopolysaccharide biosynthesis proteins [BR:etc01005]
    ETAC_06140 (arnT)
Enzymes [BR:etc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.43  lipid IVA 4-amino-4-deoxy-L-arabinosyltransferase
     ETAC_06140 (arnT)
Glycosyltransferases [BR:etc01003]
 Polysaccharide
  Bacterial polysaccharide
   ETAC_06140 (arnT)
Lipopolysaccharide biosynthesis proteins [BR:etc01005]
 Lipid A
  ETAC_06140 (arnT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PMT PMT_2
Motif
Other DBs
NCBI-ProteinID: AGH73353
Position
1412470..1414128
Genome map
AA seq 552 aa AA seqDB search
MKKIAGWVTLAVLFVLYYIVPLPGRLLWQPDETRYAEISREMLASGDWIVPHFLGLRYFE
KPVAGYWVNNLGQWLFGDGNFAVRFGAVLATVLSALLVFWLARRLLSGTRPAVLAALIYL
TSFLVYGVGSYAVLDPIFTLWMTAAMCSFWLGEQASSTRGRVGGYILLGLACGMGFMTKG
FLALAIPVIAVLPWVIAQRRWKSLFCFGPLAVLSAILISLPWVLAIAQREPDYWRYFFWV
EHIQRFAEDNAQHKAPFWYYLPILLLGLLPWLGLLPGALREGWRGRVSQGGDFYLLGWAV
MPFLLFSIAKGKLPTYILPCFAPLAILMAGYVQRLAGEGGKALRINGVINLLVGLGGMAA
ILLVLAPWGIIGRPLFGAQEVSKVILGTVAFGVWALFGALSLHNPRRYWRWSAACPLGIA
LLIGAALPQQVMESKQPQTLIQAAMPQLQASRYILSDSVGVAAGLAWELKRSDIYLYDNT
GELQYGLSYPDAAGHLVNAAQFPVWLAEHRKQGAVSLVLLLSRNEQVSSALPPADMTLRK
GRFLLLQYQQQP
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagatcgccggatgggttacgctggccgtactgttcgttctttactacatcgtc
ccgctaccgggacgtttattatggcagccggatgaaacccgctatgccgaaattagccgc
gagatgctggccagcggagactggatcgtgccgcactttctcgggctgcgctattttgaa
aagccggtggccggctattgggtgaataacctgggtcagtggctgtttggcgacggcaat
tttgccgtccgctttggcgccgtgctggcgacggtactgagtgcgctgctggtgttctgg
ctggcgcgccggctactgtctggcacgcgtccggccgttttggctgcgctgatttatctg
accagctttctggtctacggcgttggcagctacgcggtgcttgatccgatctttaccctg
tggatgaccgcggccatgtgcagcttctggctgggtgagcaggccagcagtacgcggggc
cgggtcggcggctacattttgctggggttggcctgcggtatgggctttatgaccaaaggg
ttcctggcgctggcgatcccggtgattgccgttctgccctgggtgatagcccaacggcgc
tggaaatccctgttctgctttggcccgctggcggtgttgagcgccattctcatcagcctg
ccgtgggtgctggctatcgcacagcgcgagccggactattggcgctacttcttctgggtt
gagcatatccagcgctttgccgaagataacgctcagcataaggcgccgttctggtattac
ctgccgatcctccttctcggcctgctgccctggctgggcctgctgcccggcgcgctgcgt
gaggggtggcgtggccgggtcagtcaggggggggatttttacctgctgggctgggcggtg
atgccatttctgctgttcagcatcgccaaaggaaagctgccaacctatattttaccctgc
tttgcgccgctggcgatcctgatggccggctatgtacagcgtctggccggagaggggggt
aaggcgctacggatcaacggggtgattaacctgctggtcggcttgggtggcatggcggcg
atcttgctggtgctggcgccctggggcatcatcggacgtccgctgttcggtgcgcaggag
gtcagcaaagtgatcctgggcaccgtcgcctttggcgtatgggcgctgtttggcgcgctg
tcgctgcataatccacgccgctactggcgctggagcgccgcctgtccgctggggattgcc
ctgctgatcggcgcggcgctgccgcagcaggtcatggagtccaagcagccgcagacgctg
atccaggcggcgatgccgcagctgcaggcgagccgctatattctgagcgacagcgtcggc
gtcgccgcggggctggcctgggagctcaagcgcagcgacatctatctgtatgataatacg
ggtgagcttcagtatgggctgagctatccggatgcggccggtcatctggtaaatgccgcg
cagttcccggtctggctggcggagcaccggaagcagggggcggtctccctggtattgctg
ctgtcgcgcaacgaacaggttagttcggcgctgccgccagcggatatgaccctgcggaag
gggcgtttcctgctgttgcagtatcagcagcagccatga

DBGET integrated database retrieval system