KEGG   Edwardsiella piscicida C07-087: ETAC_06230Help
Entry
ETAC_06230        CDS       T02509                                 

Definition
(GenBank) Phosphoglycerate transport system transcriptional regulatory protein PgtA
  KO
K08476  two-component system, NtrC family, phosphoglycerate transport system response regulator PgtA
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
Module
etc_M00503  PgtB-PgtA (phosphoglycerate transport) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_06230
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:etc02022]
    ETAC_06230
Two-component system [BR:etc02022]
 NtrC family
  PgtB-PgtA [MD:M00503]
   ETAC_06230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Sigma54_activ_2 HTH_8 Sigma54_activat AAA_16 AAA_22
Motif
Other DBs
NCBI-ProteinID: AGH73369
Position
complement(1427738..1428973)
Genome map
AA seq 411 aa AA seqDB search
MLTSEHAILLIDDDPDVLDAYTLLLTQSGYAVHACADPLQALAMIPDDWPGVILSDVCMP
GCSGITLMERLRTRDSQLPVLLITGHGDVPMAVEAVKKGARDFLQKPVDPAQLLALTQAA
LCERRSVIARRKWQRHQLQTELVGRSEWLRQMRTRLQQLAETDLAVYFYGDPGSGRTLCA
RHLHRLSARCEGAFIVHQAGDDDIQRSIDRAHGGTLLIPHPERLNEAAQYSLVRSQSHEP
HAFRLLAIGEGPLVEHAAAQRILPDLYYCFAMTQLACPPLSQRPDDIEPLFEHYLQQACL
RLNHPRPILPASLRKSLLQRHWANNVRELANAAQLFAVGVQPLAEVACPQVHEASPTPLD
RRVEEYERQIITEALNLHQGRINEVAEYLQIPRKKLYLRMKKYHLDKTHYR
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgctgaccagtgaacacgccattttattgattgatgacgatcccgacgtactggacgcc
tataccctgctgctgacgcaaagcggctatgccgttcacgcctgcgccgatccgctgcag
gcgctggccatgatccccgatgattggcccggggtgattctcagcgacgtctgtatgccg
ggctgctccgggattaccctcatggagcgcctgcgcacccgcgatagccagctgccggtc
ctgctcatcaccggccacggcgacgtcccgatggccgtcgaggccgtcaaaaaaggcgcg
cgtgattttctgcagaagccggtcgatccggcgcagctgctggcgctgacgcaggcggcg
ctctgcgagcggcgatcggtgatcgcccgccgcaagtggcagcgtcaccagctgcagacc
gagctggtcggacgcagcgaatggctgcgtcagatgcgtacccgcctgcagcagctggcg
gagaccgatctggccgtctatttttacggcgaccccggcagcggccgaaccctgtgcgcc
cgccatctgcaccgtctgagcgcacgctgcgaaggcgcctttatcgtgcatcaggccggc
gacgacgatatccagcgcagcatcgaccgggcgcacggcggaacgctgctgatcccgcac
ccggagcgcctgaacgaagccgcgcagtacagcctggtgcgcagccaaagccacgagccg
cacgcctttcgtctgctggccatcggcgagggaccgctggtggagcacgccgcggcgcag
cgtatcctgccggatctctactactgcttcgcgatgacccagttggcctgcccgccgctg
tcccagcggccggacgatatcgaaccgctgtttgagcactacctgcagcaggcctgcctc
cggctcaaccatccccggcccatcctgcccgccagcctgcgcaaaagcctgctacagcgc
cactgggccaacaacgtccgcgagctggccaatgccgcccaactgttcgccgtcggcgtg
cagccgctggcggaggtcgcctgtccccaggtgcacgaagccagccccaccccccttgac
cgacgcgtcgaagagtatgagcgtcagatcatcaccgaagccctcaacctgcatcagggg
cgaatcaatgaggtggcggagtacctgcagatcccgcgcaagaaactgtatctgcgaatg
aagaagtaccacctcgataagacccactaccgctga

DBGET integrated database retrieval system