KEGG   Edwardsiella piscicida C07-087: ETAC_06235Help
Entry
ETAC_06235        CDS       T02509                                 

Definition
(GenBank) phosphoglycerate transport: protein for signal transmission
  KO
K08475  two-component system, NtrC family, phosphoglycerate transport system sensor histidine kinase PgtB [EC:2.7.13.3]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
Module
etc_M00503  PgtB-PgtA (phosphoglycerate transport) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_06235
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:etc01001]
    ETAC_06235
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:etc02022]
    ETAC_06235
Enzymes [BR:etc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     ETAC_06235
Protein kinases [BR:etc01001]
 Histidine kinases
  NtrC family
   ETAC_06235
Two-component system [BR:etc02022]
 NtrC family
  PgtB-PgtA [MD:M00503]
   ETAC_06235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HAMP HisKA HATPase_c_2 4HB_MCP_1 HATPase_c_3 HATPase_c_5
Motif
Other DBs
NCBI-ProteinID: AGH73370
Position
complement(1428960..1430987)
Genome map
AA seq 675 aa AA seqDB search
MKRLLRQARRLSISASLQIAFLASALLTLFVSAVSLYSWHAQSSQVRYTLDDYFPRIQSS
LVIENALNTLVDQLNEFVLAPDTSVRLQFRQQIVSHLTQIERLSHRLEPGERHQLAGILQ
QSRQLLSTLDNALYTLFLAREKTNEVAGRITWLHDDFTTELNSLMQDFSWQQGALIDQME
GRDAATMHRLQQRLRAVQQEQQQVYALARLENQITNDLRDRIGELYNSDNGAINMDGHRR
YLEYLRNSAAEIMQPLTALPSTVTLRQTIDELLDIGLGAGKLPATLADYQQARNALLLAT
QQKERTLNRFRAVLEQQLDTSHRRMQTFNQRLEHIIRVSGRLILIATLLSLLLALLLSYG
FIRSRLVKRFTALSQAVARIGTGDRTTRIPVYGVDELGRIARLLRRTLSQQHRQQRRLER
EVAERKAIEHHLRTTQDELIQAAKLAVVGQTMTTLAHEINQPLNALSMYLFSARRALESG
QQAQAEATLQKCDGLIGRMDAIIRSLRQFARRADDSPLHPLALRQAWLSAWELLAPRHRR
LQAQLTLPVDDVWIRADDVRLQQVLVNLLTNALDAAEQPMHIEVSWRQSAGRLEVTLCDD
GPGWPLALAHRLLKPFTTSKQVGLGIGLSISQSLMEQLGGELRIASALPHGACILLCFTL
ADAPPHLTETLNADQ
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atgaagcggttgctgcgtcaggcccgccgcctaagcatcagcgccagcctgcagatcgcc
tttctggccagtgcgctgctgaccctgtttgtcagcgccgtcagcctctactcttggcat
gcgcagagctcccaggtgcgctataccctggatgactatttcccgcgcattcagtcctcg
ctggtgatcgaaaacgccctgaataccctggtcgatcagctcaatgagtttgttctggcg
cccgataccagcgtgcgtctgcagttccgccagcagatcgtcagccacctgacgcagatc
gaacggctcagccaccgcctggagccgggagagcgccatcagctggccgggatcctgcag
cagagccgccagctcctcagcacgctggacaatgcgctctacacgctgtttttggcgcgg
gaaaagaccaacgaagtcgccggacgcattacctggctgcacgatgacttcaccaccgag
ctgaactccctgatgcaggacttcagctggcagcagggcgcgctgatcgatcagatggag
gggcgcgacgccgccacgatgcaccggctacagcagcgtctgcgggcggtgcagcaggag
cagcagcaggtgtatgccctggcccgcctggagaatcagataaccaacgatctgcgcgat
cggataggcgagctgtacaacagcgacaacggcgccatcaatatggacggccaccggcgc
tacctggagtacctgcgcaacagcgccgccgaaatcatgcagcccctgaccgcgctcccc
agcacggtaaccctgcgccagaccatcgacgagctgttggatattggcctcggcgcaggg
aagcttccggcaaccctggccgactatcagcaggcgcgtaacgcgctgctgctggcgacc
cagcagaaagagcgcaccctcaacaggttccgcgccgtgctggagcagcagctggatacc
agccaccgccggatgcagacgtttaaccagcggctggagcatatcattcgcgtcagcggc
cggctgatccttatcgcgaccctgctctccctgctgctggcgctgctgctgagctacggc
tttatccgttcacggctggtgaagcgctttaccgcgctgagccaggccgtagcgcgcatt
ggcaccggcgatcgcaccacgcggatcccggtgtacggggtcgatgagctggggcgtatc
gcccgcctgctgcgccgcacgctgagccagcagcaccgccagcagcgccgcctcgagcga
gaggtcgccgagcgtaaagcgatagagcaccatctgcgcaccacccaagatgagctgatc
caggccgccaagctggcggtggtcggccaaaccatgaccacgctggcccatgagatcaac
cagccgctgaacgccctgtcgatgtatctgttctccgcccgccgggcgctggagagcggc
cagcaggcgcaggccgaagccacgctgcaaaagtgcgatggcctgatcggccgtatggat
gccattatccgctcgctgcgccagtttgcccgccgcgccgacgacagccccctgcacccg
ctcgcactgcgccaggcctggcttagcgcgtgggagctgctggcgccgcgccaccggcgc
ctacaggcacagctgacgctaccggtcgatgacgtctggatccgcgccgatgacgtccgc
ctgcagcaggtgttggtcaatctgttaaccaacgcgttggacgccgccgaacagccgatg
cacatagaggtgagctggcgccagagcgcgggacgccttgaggtcacgctgtgcgatgac
ggccccggctggccgctggcgctggcgcaccgactgctcaaaccctttaccaccagtaaa
caggtggggctgggaatcggcctctccatcagccagtcactgatggagcagctgggcggc
gagctacgtatcgcctccgccctgccgcacggcgcctgtattctgctctgttttaccctg
gcggacgccccgccgcatctgacggaaaccctgaatgctgaccagtga

DBGET integrated database retrieval system