KEGG   Edwardsiella piscicida C07-087: ETAC_06240Help
Entry
ETAC_06240        CDS       T02509                                 

Definition
(GenBank) Phosphoglycerate transport regulatory protein PgtC
  KO
K08478  phosphoglycerate transport regulatory protein PgtC
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_06240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_6 SBP_bac_11 SBP_bac_8 MutS_III
Motif
Other DBs
NCBI-ProteinID: AGH73371
Position
complement(1430984..1432216)
Genome map
AA seq 410 aa AA seqDB search
MYRACLTLIILLSLPLTLQAKRSELVMATTFSPQATAYIISRWQHQPGAVPIRTINRTSA
SLEQLLDNLNDGHIDLVLTSSPMLLQHLQDHHRLAPIDAQPAELQRQIPESIRATSVAVA
LSGFGLLINRSNLAAQHLPPPKDWEDLTLPQYRDMLLMSSPSRSDTNHLMIESLLQQYGW
ERGWQILLMAAGNLSTISSRSFGVADKIQTGLGTLGPVIDNYAQMLSTDPHLTFHYFPHS
VAAPTYVAVTRDALYPGEARRFIRFLLSPDGQRALADTNTGKYPIVALPGNSARAQQQRR
LLAQPQMDYRLILLRQRLVQALFDTAISFRLPQLKDAWRALNAAEARQKHPLPHIRALLT
AMPISAAQSEDPTLLAQCSSRAGCEQLMMEWQQFFHQKQRQAINQLENLK
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgtaccgcgcctgtctaaccctgataatactgctgtcgctgccccttacgctgcaggcc
aaacgcagcgaactggtcatggcgaccaccttctcgccccaggccacggcctacattatc
agccgttggcagcatcagccgggcgcggtgcccatccgcaccatcaaccgcaccagcgca
tcgctggagcagctgctggacaaccttaacgatggtcatatcgatctggtgctcacctcc
tcgccgatgctgctgcagcatctgcaggatcaccatcgtctggcgcccatcgacgctcag
ccggccgagctgcagcgccaaattcccgaatcgatccgcgcgacctcggtggcggtggcg
ctctccggctttggtctcttgatcaaccgcagtaatctggcggcccagcacctaccgccg
ccgaaggattgggaggatctcaccctgccccagtaccgcgatatgctgttaatgagcagc
ccgtcgcgatccgataccaaccacctgatgatcgagtccctgctacagcagtacggctgg
gagcgcgggtggcagatcctgctgatggccgccggcaacctcagcaccatctcctcgcgc
agctttggcgtcgccgataagatccagaccggtctcggcaccctcggcccggtcatcgac
aactatgcccagatgctcagcaccgacccccatctgacgttccactatttcccgcacagc
gtcgccgccccgacctacgtggcggtcacccgcgacgcgctctaccccggagaggcccgg
cgctttatccgctttctactcagccccgacggccagcgcgccctggccgacaccaacacc
ggaaagtatcccattgtcgccctgccgggcaactccgcccgcgctcagcagcagcggcga
ctgctggcgcagccgcagatggactaccgcctgatcctgctgcgccagcgtctggttcag
gcgctgtttgacaccgccatcagcttccggctgccgcagctcaaggatgcctggcgcgcc
ctgaacgccgccgaagcccggcagaaacatccgttgccccacattcgcgccctgctgacg
gccatgccgatcagtgccgcgcagagcgaagacccgacgctgctggcgcagtgcagcagc
cgggctggatgcgaacagctgatgatggagtggcagcagtttttccaccaaaagcagcgc
caggcgattaatcagctggaaaacctgaaatga

DBGET integrated database retrieval system