KEGG   Edwardsiella piscicida C07-087: ETAC_06245Help
Entry
ETAC_06245        CDS       T02509                                 

Definition
(GenBank) transporter
  KO
K11382  MFS transporter, OPA family, phosphoglycerate transporter protein
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_06245
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_06245
Transporters [BR:etc02000]
 Major Facilitator Superfamily (MFS)
  Phosphate and organophosphate transporters
   Organophosphate:Pi antiporter (OPA) family [TC:2.A.1.4]
    ETAC_06245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 OATP LacY_symp
Motif
Other DBs
NCBI-ProteinID: AGH73372
Position
1432699..1434003
Genome map
AA seq 434 aa AA seqDB search
MSVFLGYMAYYIVRNNFTLSTPYLKEQLDLSATQIGLLSSCMLIAYGISKGVMSSLADKA
NPKIFMACGLVMCALVNVGLGFSSAFWLFVALVVCNGLFQGMGVGPSFITIANWFPRCER
GRVGAFWNISHNVGGGIVAPIIGVAFAMLGNEHWQSASYMVPAGIAVLFAGVVLLLGKRS
PKKEGLPALDEMMPEEKVVLKGHAQAHAPENMTAFQIFCTYVLKNKNAWYISMVDVFVYM
VRFGMISWLPIYLLTEKNFSKEQMSIAFLFFEWAAIPSTLLAGWLTDKLFHGRRMPLAII
CMAMIFVCLIGYWQSNSLAVVTVFAAIVGCLIYVPQFLASVQTMEIVPSFAVGSAVGLRG
FMSYIFGASLGTSLFGVMVDRFGWHGGFYLLMGGVVCCILFCILSHRGALELERQRQQAL
NDAAPEMTLRPAAE
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtgttcctggggtatatggcgtattatattgtgcgtaataactttacgctttct
acgccttatctgaaagagcagttggatttaagtgcaacccaaattggcttattaagtagc
tgtatgctgattgcctacggcattagcaaaggggtgatgagtagcctggcggataaagcc
aacccgaaaatctttatggcctgcggcctggtgatgtgtgcgctggttaacgtggggctg
ggatttagcagcgccttttggctgtttgttgcgctggtggtctgtaacggcctgttccag
gggatgggggtcggcccttcctttatcaccattgccaactggttcccgcgctgtgagcga
ggccgcgtcggtgccttctggaatatctcccacaacgtgggcgggggcatcgtggcaccg
atcatcggcgtcgcctttgccatgctgggcaatgaacactggcagagcgccagctatatg
gtcccggccggcatcgccgtactctttgccggcgtagtgctgctgctgggtaagcgctca
ccgaagaaagaggggctgccggcgctggatgagatgatgccagaggagaaggtggtgctg
aaggggcatgctcaggcccatgcaccggaaaatatgacggcgttccagatcttctgcacc
tacgtgctgaagaataaaaatgcctggtatatctcgatggtcgatgtgttcgtctatatg
gtgcgcttcggcatgatcagctggctccccatctacctgctgacggagaaaaacttcagc
aaggagcagatgagcatcgcgttcctgttctttgaatgggcggcgatcccgtcaaccctg
ctggccgggtggctgaccgacaagctgttccacggtcgtcgtatgccgctggccatcatc
tgcatggcgatgatctttgtctgcctgatcggctactggcagagcaactcgctggccgtt
gtcaccgtctttgctgccatcgtcggctgcctgatctatgtaccgcagtttttggcctca
gtgcagaccatggagatcgtccccagctttgccgttggctctgccgttggactgcgtggc
ttcatgagctacatcttcggtgcgtcgctgggaaccagcctgtttggtgtgatggtagac
cgcttcggctggcacggcggtttctatctgttgatgggcggggtggtgtgctgcatcctg
ttctgtatcctgtctcaccgcggggcgctggagctggagcgtcagcgtcagcaggcgctg
aatgacgccgcgccggagatgacgctgcggcccgccgcggagtaa

DBGET integrated database retrieval system