KEGG   Edwardsiella piscicida C07-087: ETAC_06270Help
Entry
ETAC_06270        CDS       T02509                                 

Gene name
fbpC
Definition
(GenBank) ferric transporter ATP-binding subunit
  KO
K02010  iron(III) transport system ATP-binding protein [EC:7.2.2.7]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02010  ABC transporters
Module
etc_M00190  Iron(III) transport system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_06270 (fbpC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_06270 (fbpC)
Enzymes [BR:etc01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.7  ABC-type Fe3+ transporter
     ETAC_06270 (fbpC)
Transporters [BR:etc02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Iron(III) transporter [MD:M00190]
    ETAC_06270 (fbpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran TOBE_2 AAA_21 AAA AAA_16 SMC_N CysA_C_terminal RecA Rad17 AAA_25 ATPase AAA_14 AAA_22 RsgA_GTPase AAA_5 ATP-synt_ab AAA_29 AAA_24 AAA_23 AAA_30 ABC_ATPase AAA_33 G-alpha
Motif
Other DBs
NCBI-ProteinID: AGH73377
Position
complement(1439227..1440273)
Genome map
AA seq 348 aa AA seqDB search
MDQNSFVELRSVTKRFGSNTVIDDINLTIPRGQMVTLLGPSGCGKTTILRLVAGLEKPSE
GQIFIDGEEVTHRAIQQRDICMVFQSYALFPHMSLGENIGYGLKMLGVAKAEIVTRVKEA
LALVDLAGFENRYVDQISGGQQQRVALARALILRPKVLLFDEPLSNLDANLRRSMRDKIR
ELQTQFDITSLYVTHDQSEAFAVSDAVLVMNQGHIMQIGSPQALYRQPASRFMASFMGDA
NLLPATFSPESVAIYGYHLPRPTHFASQGHGTVGVRPEAITLSERGDESQRCEIRHVAYM
GPQYEVRVAWHGQELLLQVNATRLQPDVGERYYLEIHPYGMFVLTDPA
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggatcagaacagtttcgttgagctgcgcagcgtcaccaagcgattcggcagcaatacg
gttatcgacgacattaacctcaccatcccccgagggcagatggtcacgctgctcggcccc
tccggctgcggtaaaaccaccattttgcgtctggtggccgggctggagaaacccagcgag
gggcagatttttatcgacggcgaagaggtgacccaccgcgccatccagcagcgtgatatc
tgcatggtgttccagtcctacgccctgtttccccatatgtcgctgggcgagaacatcggc
tatggcctgaagatgctcggcgtggcaaaggcggagatcgtcacccgggtgaaagaggcg
ctggcgctggtggatttggcggggttcgaaaatcgctacgtggatcagatctccggtggc
cagcagcagcgcgtggcgctggcgcgggcgctgatcctgcgccccaaggttctgctgttt
gatgagcccctgagtaacctggacgccaacctgcgccgcagcatgcgcgacaagatccgc
gagctgcaaacgcagtttgatatcacatctctgtatgttacccacgatcagagcgaggcc
tttgccgtctctgacgccgtgctggtgatgaatcaggggcatatcatgcagataggctca
ccgcaggcgctctaccgtcagccggcatcgcgctttatggccagctttatgggggacgcc
aacctgcttccggccacctttagcccggagagcgtggcgatctacggctatcacctgccg
cgcccgacgcactttgccagccagggccacggcaccgtcggcgtacgcccggaggccatc
accctgagcgagcgcggcgatgagagccagcgctgtgagatccgacacgtggcctacatg
ggcccgcagtatgaggtcagggtcgcatggcacgggcaggagctcctgctgcaggtgaac
gccacccgcctgcagccagacgtcggcgagcgctattatctggagattcatccctatggc
atgtttgttctgaccgaccccgcctag

KEGG   Edwardsiella piscicida C07-087: ETAC_13345Help
Entry
ETAC_13345        CDS       T02509                                 

Definition
(GenBank) Ferric iron ABC transporter, ATP-binding protein
  KO
K02010  iron(III) transport system ATP-binding protein [EC:7.2.2.7]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02010  ABC transporters
Module
etc_M00190  Iron(III) transport system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_13345
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_13345
Enzymes [BR:etc01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.7  ABC-type Fe3+ transporter
     ETAC_13345
Transporters [BR:etc02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Iron(III) transporter [MD:M00190]
    ETAC_13345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_16 AAA_30 SbcCD_C AAA AAA_29 AAA_25 AAA_33 AAA_23 AAA_22 AAA_28 AAA_18 RsgA_GTPase NACHT AAA_19 G-alpha
Motif
Other DBs
NCBI-ProteinID: AGH74790
Position
2999946..3000629
Genome map
AA seq 227 aa AA seqDB search
MNEMALCLDNLHVSYGAGASAQPVLNGFSLSLRQGTLACLLGASGSGKTTVLRAIAGFER
LDRGSIRIAGRCVASPQQHLAPELRRVGMVFQDYALFPHLTVAQNIAFGLRRQPRAVQRA
RVADLLQLIELSGIGERYPHALSGGQQQRVALARALAPQPDILLLDEPFSSLDEGTRERL
GQEVRAILAAAGQTALLVTHSAQEARTMGGPILHIAHGQALSCADAA
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaaatggccttatgcctggataatctgcacgtcagctatggcgcgggcgccagc
gcccagccggtgctgaacggtttctccctgtctctgcgtcaggggacgctggcctgcctg
ctcggcgcctccggcagcggtaagaccaccgtgctgcgcgcgatcgccgggtttgaacgc
ctcgaccgcggcagcatccgcatcgccgggcgctgcgtggcatcgccgcagcagcatctg
gcgccggagctgcgccgcgtcggcatggtgtttcaggactatgcgctgttccctcacctg
accgtggcgcagaacatcgcctttggtctgcgtcgccagccgcgcgccgtccagcgggcg
cgcgtcgccgatctgctgcagctgatcgagctgtcggggatcggcgaacgctacccgcac
gccctctccggcggccagcagcagcgcgtcgccctggcgcgagccctggccccccagccg
gatatcctgctgctggatgagcccttctccagcctggacgaaggcacccgcgaacgttta
ggccaagaggtgcgggcgatcctcgccgccgccggacagaccgcgctgctggtaacccac
agcgcccaggaggcgcgcacgatgggcggcccgatcctgcatatcgcccacggtcaggcg
ctgagctgcgccgacgcggcgtaa

DBGET integrated database retrieval system