KEGG   Edwardsiella piscicida C07-087: ETAC_06275Help
Entry
ETAC_06275        CDS       T02509                                 

Definition
(GenBank) Ferric iron ABC transporter, permease protein
  KO
K02011  iron(III) transport system permease protein
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02010  ABC transporters
Module
etc_M00190  Iron(III) transport system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_06275
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_06275
Transporters [BR:etc02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Iron(III) transporter [MD:M00190]
    ETAC_06275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: AGH73378
Position
complement(1440285..1442357)
Genome map
AA seq 690 aa AA seqDB search
MSHTLTQPPVAKRDTLRLWILLGWLAFALLPSWSLDYGLLASTPDEILAAYGWSQLNISW
LWYLLPTLLLIRRRGAPTSRRRDYADAGGALCCILFVAISATVEGRGLGYAAIALFVALG
AIMTQALARLEWLGGDRFVIGSLIAIVALIGVFIVWPSIAIFIPMFTDEHGAFAPLAFTQ
VLAQAHILQVILNSIALSIAVGIGCTFFGLVLAIYTTRIAKRSAIIGRVFSILPIVTPPF
VVGLGVTLMMGRSGYITEGMAAWFGLTNTNWLYGFTGIWLAQVLAFTPMAFMILDGAIKT
IPPSLEEASYTLRASRWQTFRGVFIPLLKPALANAFLIVVVQSLADFSNPLVLGGNFDVL
ATQIYFYITGSQLDYQAASTLGVFLLLFSLLVFCVQYLWIGKRSYVTVSGKSYRGDVQPL
PTALVWGVIALLTLWVLFNALLYGSIFYGSFTVNWGVDYTLTLNNFITLFGQGMHDGAWP
SLLDTLLYAGIAAPITAAFGLLIAWIVVRQQFTGKKTIEFTTMLCFAVPGTVAGVSYILA
FNSAPVYLTGTAAIVIISMIMRNVPVGIRAGIAGLGQIDKSLDEASLSLRAGSLRTITHI
LLPLLRPAILSALIYSFVRAVTTVSAIVFLVTPDTRVATAYILNRVEDGEYGVAIAYGSI
LIVVMLAIIFLFDWLIGEARTSRSKANDPA
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atgtcacacaccctaacgcagcctcccgtagccaagcgggatacgctacgcctttggatt
ttactcggctggctggcctttgcgctgctgccaagctggagcctggactatggtctgctg
gcgtcaacgcccgacgaaattctggcggcctacggctggtcacagctcaacatcagctgg
ctgtggtacctgctgccgaccctgctgctgatccggcgccgtggggcgccgacgtcgcgc
cgccgcgactacgctgacgccggcggggcgctatgctgtatcctctttgtggcgatcagc
gccacggtggaaggtcgggggctggggtacgcggcgatcgcgctgtttgtcgcgctcggc
gccatcatgacgcaggcattggcccgcctcgaatggctgggcggcgatcgcttcgtgatc
ggctcgctgatcgcgatcgtcgcgctgatcggcgtgtttatcgtctggccgagcatcgcg
atttttatcccgatgtttaccgacgaacacggcgcctttgccccgctggcgttcacccag
gtgctggcgcaggcgcacattctgcaggtgatcctcaactcgatcgcgctgtcgatcgcg
gtggggatcggctgtaccttctttggcctggtgctggctatctataccacccgcatcgct
aagcgcagcgccattatcggacgcgtattctccattctgcccatcgttacgccccccttt
gtcgtcggcctgggcgtaacgctcatgatggggcgttccggctatattaccgaagggatg
gcggcgtggttcgggctaaccaataccaactggctgtatggcttcaccggtatctggctg
gcccaggtgctggcctttaccccgatggcctttatgatcctggatggcgccatcaagacc
atccccccctcgctggaggaggcctcatacacgctgcgcgccagccgttggcagaccttt
cgcggggtgtttattcccctactcaagcccgcgctggccaacgcgtttctgatcgtggtc
gtgcagtcgctggccgactttagcaacccgctggtgctcggcggcaacttcgatgtgctg
gcgacgcaaatctacttttatatcaccgggtcacagctcgactaccaggccgccagcacc
ctcggcgtatttctgctgctgttctcgctgctggtgttttgcgtacagtatctgtggatc
ggcaagcgctcctacgtcaccgtgtccggcaaatcctatcggggcgacgtacagccgctg
ccgacggcgctggtatggggtgttatcgcccttctgacgctctgggtcctgttcaacgcc
ctgctctacggcagcattttctacggcagcttcaccgttaactggggggtggactatacc
ctgaccctgaataactttatcacgctgttcggccagggaatgcacgatggggcgtggccc
tcgctgctcgacaccctgctctacgccggcattgcggcgccgatcaccgccgcgtttggc
ctgctgatcgcctggattgtggtacggcaacagttcaccggcaaaaagaccatcgagttc
accaccatgctctgctttgccgtgccgggtaccgtggccggcgtatcctacattctggcc
tttaacagcgcgccggtatacctcaccggaacggcggcgatcgtgatcatctccatgatc
atgcgcaacgtaccggtcggcatccgcgcgggcatcgcgggcctgggccagatcgataaa
tcgctggatgaggcctctctcagcctgcgcgccggctcgctgcgcaccatcacgcacatt
ttgctgccgctgctgcgcccggcgatcctgtcagcgctgatctacagctttgtgcgcgcc
gttaccacggtcagcgccatcgtgttcctcgtgacgcccgatacccgcgtcgccaccgcc
tacatactgaaccgggtggaggacggcgagtacggggtcgccatcgcctatggttcgatc
ctgatcgtcgtgatgctggcgatcattttcctctttgactggctgatcggcgaggcgcga
acctcccgctcaaaagccaatgaccccgcctaa

KEGG   Edwardsiella piscicida C07-087: ETAC_13340Help
Entry
ETAC_13340        CDS       T02509                                 

Definition
(GenBank) Ferric iron ABC transporter, permease protein
  KO
K02011  iron(III) transport system permease protein
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02010  ABC transporters
Module
etc_M00190  Iron(III) transport system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_13340
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_13340
Transporters [BR:etc02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Iron(III) transporter [MD:M00190]
    ETAC_13340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: AGH74789
Position
2998288..2999949
Genome map
AA seq 553 aa AA seqDB search
MSRRIRGALPHPTPLALGAMAVALLAITPLLSLLWLAADGGVQHWRDLWRYVLPQAALNT
LLLLVGVALLAGAIGVGCAWAVSAFQFPGRRLLSWGLLLPLAMPTYIVAFSWLDLLHPIG
PLQSALRLLLGYDSPRQFRLPDIRGVAGAIVLFSLVLYPYIYLTMRAMFISQPAHLLEAA
RTLGENGRGTFLRVVLPMARPALAVGISLALLETLNDLGASEFLGVQTLTVAVYTTWITR
SDIAAAAQIACMMLGFIFLLLTLELYGRRRQRYAGRGLRTLQPQPLRGLRAWLLSAATAL
PLLLGFIIPLLHLIWQSLKRLDSQTLLSAELLAALRNTLLLSLGVTLLAVAISLALSWYA
RIRALAPPTPPLRRITLRLASLGYAVPGTILAIGFMPPALRADAWLATALEIRGLPLFSC
GLLLILCCTLRFQTITLGALDAGLARIAPSLEQAARSLGEREGATFWRVHLPLLRPALIG
SALLVFADVMKELPITLLLRPVNVETLATLLYAEAARGTYEDGAIAALLIVLAGTLPMTL
LVRNQLKHAGESR
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgagccgccggatacgcggcgccctgccgcacccgacgccgctggcgctgggcgcgatg
gccgtcgccctgctggcaattaccccgctgctctcgctgctgtggctagccgccgacggc
ggggttcagcactggcgcgatctgtggcgctatgtcctaccgcaggccgcgctgaatacc
ctgctgctgctggtcggggtggcgctgctggccggcgccatcggcgtcggctgcgcctgg
gcggtgagcgcctttcagttccccgggcggcgcctgctgagctggggactgctgctgccg
ctggcgatgccaacctacatcgtcgccttctcttggctggatctgctgcacccgattggc
ccgctacagagcgcgctgcgcctgctgctcggctatgacagcccgcgccagttccgcctg
ccggatattcgcggcgtcgccggggctatcgtgctgtttagcctggtgctctacccctat
atctatctgacgatgcgggcgatgttcatcagccagcccgcacacctgctcgaggcggca
cgcaccctcggcgaaaacgggcgcggcacctttctgcgcgttgtgctgcccatggccaga
ccggcgctggcggtcggtatcagcctagcgctgctggagaccctgaacgatctcggcgcc
tcggagttcctgggggtgcagaccctgaccgtcgccgtctataccacctggatcacccgc
tcagacatcgccgccgccgcccagatcgcctgcatgatgctgggatttatcttcctgctg
ctgacgctggagctatacggacgccggcgccaacgctacgcggggcgcggtctgcgtacc
ctgcaaccgcagcctctgcgcggcctgcgcgcctggctgctcagcgccgcgacggcgctg
ccgctgctgctcggctttatcattccgctgctgcacctgatctggcagagcctgaagcga
ctggacagccagaccctgctctccgccgagctgctggcggcgctgcgcaataccctgctg
ctgtcgctgggggtcacgctgctggcggtggcgatcagcctggcgctcagctggtatgcc
cgcattcgggcgctggcgccgcccacgccgccgctgcgccggatcaccctgcgcctcgcc
tcgctgggctatgccgtaccgggcaccattctggccattggctttatgccgccggcgctg
cgcgccgatgcctggctggcgacggcgctggagatacgcggtctgccgctgttctcctgc
ggcctgctgctgatcctgtgctgcaccctgcgctttcagaccattaccctcggcgcgctg
gacgccgggctggcgcgtatcgccccatcgctagaacaggcggcccgttcgctgggtgag
cgtgagggggcgaccttttggcgcgtacacctgccgctgctgcgtccggcgctgatcggc
agcgcgctgctggtcttcgccgacgtcatgaaagagctgcccattaccctgctgctgcgc
ccggtcaacgtggagacgctggcgaccctgctgtacgccgaggccgcacgcggcacctat
gaagatggcgccatcgcggcgctgctgatcgtactggccggtaccctgcccatgacgctg
ttggttcgcaaccagttaaaacacgcgggagagtcgcgatga

DBGET integrated database retrieval system