KEGG   Edwardsiella piscicida C07-087: ETAC_06280Help
Entry
ETAC_06280        CDS       T02509                                 

Definition
(GenBank) Ferric iron ABC transporter, iron-binding protein
  KO
K02012  iron(III) transport system substrate-binding protein
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02010  ABC transporters
Module
etc_M00190  Iron(III) transport system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_06280
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_06280
Transporters [BR:etc02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Iron(III) transporter [MD:M00190]
    ETAC_06280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_6 SBP_bac_8 SBP_bac_11 SBP_bac_1
Motif
Other DBs
NCBI-ProteinID: AGH73379
Position
complement(1442488..1443519)
Genome map
AA seq 343 aa AA seqDB search
MKKTLIATLMTSAVTLSMLSGAAHAQGRLVVYCSATNEMCETETRAFGEKYDVKTAFIRN
GSGSTLAKVDAEKKNPQADVWYGGTLDPQSQAGEIGLLQPYASPNLAQVMEKFRDPAKVK
GNYSSAVYIGILGFGVNTERLKEKHLPVPTCWKDLIKPEYKGEIQIADPQSSGTAYTALA
TFVQLWGEPQAFDYLKRLNANVSQYTKSGIAPARNAARGETAIGIGFLHDYSLEKEQGAP
LLLVSPCEGTGYEIGGVSILKGARNLANAKLFVDWVLSKEAQELAWKKGKSYQILTNTTA
ESSPHSLKLDDLNLISYDMDKYGSTDVRKALINKWVNDVKMGN
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaacgctgatcgctaccctgatgacctctgccgttacgctgtccatgctgagc
ggcgccgcgcacgcccagggccgtctggtcgtctattgcagtgcgacgaacgaaatgtgt
gagacggaaacccgggccttcggtgaaaaatacgatgtcaaaactgcgttcatccgcaac
ggctccggcagcaccctggccaaagtggacgccgaaaagaaaaacccccaggcggacgtc
tggtatggcggtacgctggatccccagtctcaggccggtgagatagggctgctgcagccc
tacgcctcgcccaatctggcgcaggtgatggagaaatttcgcgacccggccaaggtaaaa
ggcaactactcctcggcggtctatatcggcattctcggctttggcgtcaataccgagcgc
ctcaaagagaagcatctgccggtgccgacctgctggaaggatctgatcaaaccggagtac
aaaggtgaaattcagatagccgatccgcaaagctccggcaccgcctacaccgcgctagcg
acctttgtccagctgtggggcgagccgcaggccttcgactatctgaagcggctgaatgcc
aacgtatcccagtacaccaaatcgggcattgccccggcgcgcaacgccgcgcgcggtgag
accgccatcggcatcggtttcctgcacgattactcgctggaaaaagagcagggagccccg
ctgctgctggtctcgccctgcgagggcaccggctatgagatcggcggcgtcagcatcctg
aaaggcgcccgcaacctcgccaacgccaaactgttcgtcgactgggtgctgtcgaaagag
gcccaggagctggcctggaaaaagggcaagtcttaccagatcctgaccaacaccacggca
gagagctccccccactcgctgaagctcgatgacctaaatcttatcagctatgacatggac
aaatacggttcgaccgacgtgcgtaaggcactgatcaacaagtgggtcaacgacgttaag
atggggaactag

KEGG   Edwardsiella piscicida C07-087: ETAC_13335Help
Entry
ETAC_13335        CDS       T02509                                 

Definition
(GenBank) Ferric iron ABC transporter, iron-binding protein
  KO
K02012  iron(III) transport system substrate-binding protein
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02010  ABC transporters
Module
etc_M00190  Iron(III) transport system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_13335
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_13335
Transporters [BR:etc02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Iron(III) transporter [MD:M00190]
    ETAC_13335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_6 SBP_bac_11 SBP_bac_8 SBP_bac_1
Motif
Other DBs
NCBI-ProteinID: AGH74788
Position
2997219..2998274
Genome map
AA seq 351 aa AA seqDB search
MMRSLSTAVTAWLRLGAAGLLFGLSALPAAAADGALTLYTTREPGLIKPLLEGWTQQSGV
QVNTVYIKDGMLERLKAEGANSPADLLMTVDAGNLLDLVEAGVTQPVDSATLAQAIPANL
RGADNQWFALSMRARVLYIAKDLPDRTRTLQYQDLAKPEWHNRICMRSGQHPYNTALVAA
MIAHQGEAKTEQWLRALKANLARKPTGGDRDVARDILGGICDIGIANSYYVGHLKNAKPG
SDARQWGEAIEVIRPTFASGGTHVNISGAAVARHAPNRQAAVQLMEYLVSPEAQQRYARA
NYEYPVRQGVALDPTIADAIGTITPDPLPLTEIVKHRKQASLLVDKVGFDQ
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgtagcttatccaccgccgttaccgcctggctgcggctcggtgccgcaggcctg
ctgtttggccttagcgctctgcccgccgccgccgccgacggcgccctgacgctgtacacc
acccgggaaccggggctgatcaaaccgctgctggagggatggacacagcagagcggtgtg
caggtcaacaccgtctatatcaaagacgggatgctggagcgactgaaggccgaaggcgcc
aactcaccggccgatctgctgatgaccgtcgacgccggtaacctgctggatctggtcgag
gcgggcgtcacccagcccgtcgactccgcgacgctggcccaggccatccccgccaacctg
cgcggcgccgacaaccagtggttcgcactatcgatgcgcgcccgcgtactctacatcgcc
aaggatctacccgaccgcacgcgcacgctgcagtatcaggatctggccaagccggagtgg
cacaaccgcatctgcatgcgctcaggccagcacccctacaacaccgcgctggtggcggcg
atgatcgcccatcagggcgaagccaagaccgagcagtggctgcgcgcgctgaaggccaat
ctggcgcgtaagccgaccggcggcgatcgcgacgtggcgcgcgatattctgggcggcatc
tgcgatatcggtatcgccaactcctactatgtcggacacctgaaaaacgccaagccgggc
agtgatgcccgccagtggggcgaggcgatcgaggtgatcagaccgaccttcgccagcggc
ggcacccacgtcaacatcagcggcgccgccgtagcccgccatgcgcccaaccgtcaggcc
gcggtacagctgatggagtatctggtctcccctgaggcccagcagcgctatgcacgcgcc
aactatgaatacccggtacgccagggcgtagcgctggatccgaccatcgccgacgccatt
ggcaccattaccccggatccgctgccgctgaccgagatcgtcaaacaccgtaaacaggcc
agcctgctggtggataaagttggcttcgatcagtaa

DBGET integrated database retrieval system