KEGG   Edwardsiella piscicida C07-087: ETAC_06290Help
Entry
ETAC_06290        CDS       T02509                                 

Definition
(GenBank) Sensor histidine protein kinase UhpB, glucose-6-phosphate specific
  KO
K20263  two-component system, NarL family, sensor histidine kinase FusK [EC:2.7.13.3]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
etc02024  Quorum sensing
Module
etc_M00818  FusK-FusR (virulence regulation) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_06290
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ETAC_06290
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:etc01001]
    ETAC_06290
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:etc02022]
    ETAC_06290
Enzymes [BR:etc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     ETAC_06290
Protein kinases [BR:etc01001]
 Histidine kinases
  NarL family
   ETAC_06290
Two-component system [BR:etc02022]
 NarL family
  FusK-FusR [MD:M00818]
   ETAC_06290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MASE1 HisKA_3 HATPase_c Ufd2P_core
Motif
Other DBs
NCBI-ProteinID: AGH73381
Position
complement(1444915..1446456)
Genome map
AA seq 513 aa AA seqDB search
MSRRARYRVISLFILLAWGSGWLMLWTLGFYLTHSGQQAALFLPHGVYLALLILLSRRYW
PALVLPPMLALYWLRSEQLLNGDILLIVPLISLLPARLVQRAWHRFPLYWQRLTLLLAAV
TATALLNTALLSPWIKSPALLLGLSSFTGGVLLTPFVYLIFDFLRQQHRYHLLGLDTNNP
PLRASLLIWCSLFFIIGIGTQMVLSPEIERLLLMVVFLPNVVMAWKFGWQGGVLSGLLGS
MMITIARQIGVGFSNLLELEIFLATQALLGIGLGIAISRQQHLAQNLHHYRQRLESELAA
RRALTEQLVHTEENTRKRLARELHDEIGQNITAIQIQSQLLRQRQEPALVLSAAAQINDL
ARRIHLSTRQLLRQLRPPALDELSFQEALYHLVNEFAFAERGIRCRFDYRLDAPPAGETV
QFTLYRLLQELLNNVCKHADASAVSIVLRYHAPCLHLLVQDNGVGIGRQSPPGQGIQGMR
ERVHALGGELTLASQRGTRVIVKLPTVLQRAGA
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgccgcgcgcgttaccgggttatctccctgtttattctgctggcctggggctct
gggtggctcatgctgtggacgctgggattttatctgacccacagcggtcagcaggcggcg
ctatttttgccgcacggcgtctacctggcgctgctgatactgctctctcgacgctattgg
ccagcgctggtgctgccccccatgttggcgctgtactggctgcgcagcgagcagctgctc
aacggcgatattctgcttatcgtgccgctgatcagcctgctccccgcccggctggtgcag
cgcgcctggcaccgctttccgctctactggcagcggctaacgctgctgctcgccgccgtt
accgcaaccgcgctgctcaacaccgccctactctccccgtggattaaaagtccggcgctg
ctgctcggcctgagctcgtttaccggcggggttctgctgacgcccttcgtctacctgatc
ttcgactttctacgccagcagcatcgctatcatctgctggggctcgataccaacaacccg
cccctgcgcgcctcgctgcttatctggtgcagcctcttttttatcatcggcatcggcaca
cagatggtgctctccccggagatcgagcgcctgctgctgatggtcgtgttcctgcccaac
gtggtgatggcctggaagttcggttggcaggggggcgtgctctccggcctgctgggcagc
atgatgatcaccatcgcgcgccagattggggtcggattcagcaatctgctggagctggag
atctttcttgccacgcaggccctgctggggatcggcctgggcatcgccatcagccgtcag
cagcacctggcgcaaaatctgcaccactaccgtcagcggctggagagcgagctcgcggcg
cgccgggcgctgaccgaacagctggtgcataccgaggagaacacgcgcaaacgcctggcg
cgtgagctgcatgatgagatcggccagaacatcacggcgatccagatccagtctcagctg
ctccgacagcggcaggagcctgccctcgtgctctccgccgccgctcagatcaacgatctg
gcccggcgcattcacctctcgacccgtcagctcctgcgccagctgcgcccgccggcgctg
gatgagctgtcgttccaggaggcgctgtaccacttggtcaacgagtttgccttcgccgag
cgcgggatccgctgccgctttgattaccggctagacgcgccgcccgcgggcgaaaccgta
cagtttaccctgtaccgtctgctgcaggagctgcttaacaatgtctgtaaacacgccgac
gccagcgcggtctccatcgtactgcgctatcacgccccctgcctgcatctgctggtgcag
gataacggtgtgggcatcggccgccagagccctcccggccagggtattcagggcatgcgc
gagcgcgtccatgccctcggcggcgagctcacgctggcgtcgcagcgcggtacccgcgtc
attgttaagctgcccacagttttgcaacgcgccggcgcctaa

DBGET integrated database retrieval system