KEGG   Edwardsiella piscicida C07-087: ETAC_06295Help
Entry
ETAC_06295        CDS       T02509                                 

Definition
(GenBank) Transcriptional regulatory protein UhpA
  KO
K20264  two-component system, NarL family, response regulator FusR
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
etc02024  Quorum sensing
Module
etc_M00818  FusK-FusR (virulence regulation) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_06295
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ETAC_06295
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:etc02022]
    ETAC_06295
Two-component system [BR:etc02022]
 NarL family
  FusK-FusR [MD:M00818]
   ETAC_06295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg GerE Sigma70_r4_2 HTH_38 Sigma70_r4
Motif
Other DBs
NCBI-ProteinID: AGH73382
Position
complement(1446456..1447085)
Genome map
AA seq 209 aa AA seqDB search
MIRVVLVDDHVVVRSGFAQLLTLEPDLAVAGQFSSAAEAWQPLLRDDVSVAVLDIAMPDE
NGLSLLKRLRAKRPGFRAIILSIYDTPAFVKSALDAGASGYLTKRCGPEELVQAVRSVSM
GGHYLCADALRALRGGEPAAEALKILTPREREIFALLVKGDSVKRIAFALDLSHKTVHVH
RANVLGKLQCHSTIDLVHFALDHQLLTGL
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgatccgcgtcgtcttggtagatgaccatgtcgtggtccgctccggatttgcacagctc
ctaacccttgagcccgatctggctgtcgccggccagtttagcagcgcggcagaggcctgg
cagccgctgctgcgtgacgatgtcagcgtcgcggtgctcgatatcgccatgccggatgaa
aacggcctgagtctgctgaaacgcctgcgcgccaagaggcccggattccgcgcgattatc
ctcagcatttacgacacccccgcctttgtcaaaagcgccctggacgccggcgccagcggc
tatctgaccaagcgctgcgggcccgaagagctggtccaggcggtccgctccgtcagcatg
ggggggcactacctgtgcgccgatgcgctgcgggcgctgcgcggcggcgaaccggcggcc
gaggcgctcaaaatactcaccccgcgcgaacgcgagatctttgcgctgctggtgaagggc
gatagcgttaagcgcatcgcctttgcgctcgatctcagccataaaacggtgcacgtacac
cgggccaacgtactgggtaagctgcagtgccacagcaccatcgatctggtgcattttgcc
cttgaccaccagctgctgacggggctctga

DBGET integrated database retrieval system