KEGG   Edwardsiella piscicida C07-087: ETAC_06330Help
Entry
ETAC_06330        CDS       T02509                                 

Definition
(GenBank) flagellar motor protein MotA
  KO
K02556  chemotaxis protein MotA
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
etc02030  Bacterial chemotaxis
etc02040  Flagellar assembly
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_06330
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    ETAC_06330
   02040 Flagellar assembly
    ETAC_06330
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_06330
   02035 Bacterial motility proteins [BR:etc02035]
    ETAC_06330
Transporters [BR:etc02000]
 Other Transporters
  Pores ion channels [TC:1]
   ETAC_06330
Bacterial motility proteins [BR:etc02035]
 Flagellar system
  Flagellar assembly proteins
   Motor/switch
    ETAC_06330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MotA_ExbB EIID-AGA DUF1129
Motif
Other DBs
NCBI-ProteinID: AGH73389
Position
1452089..1452979
Genome map
AA seq 296 aa AA seqDB search
MLILLGYAVVLIAVFGGYTLVGGHLGALYQPSELLIIGGAGIGAFIVGNNGKAIKSTLRT
LPKLARGSKYNKALYMDVMGLMYQLLAKSRQQGMLSLERDIEDPKASEIFSNYPRLIADN
TLIEFITDYMRLIISGNMNAFEIESLMDEEIETFEQEAEVPAGSLAAVGDSLPAFGIVAA
VMGVVHALASADRPAAELGALIAHAMVGTFLGILLAYGFISPLASLMRQKSAETTKMMHC
IKTTLLSSLNGYAPQIAVEFGRKTLYSTERPSFIELEEHVRQVKTPAKQAATEEEV
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
gtgctgattctactgggatatgccgttgtgctaatcgcggtttttggcggttacacgctt
gttgggggccatctgggagcgttgtatcagccatctgagttattgattatcgggggagcg
ggcattggcgctttcatcgtaggcaataatggcaaggcgattaagtcgacgctgcgtacc
ctgcccaagcttgcccgcggctctaagtacaacaaggcgttgtatatggatgtgatgggg
ctgatgtatcagctcctggccaaatcgcgccagcagggcatgctctccctggagcgagat
atcgaagatcctaaggcgagcgaaattttttctaattatccccgcctgattgccgataac
acactcattgagtttattaccgactatatgcggctgatcatcagcggcaacatgaatgcc
ttcgagatcgagtccctgatggacgaagagatcgagaccttcgaacaggaagctgaggtg
ccggcaggcagcctggcggcggtgggcgactctctgccggcgttcggtatagtggcggcg
gtgatgggggttgtccatgcgctggcttcggccgatcgccccgcggcggagctgggggcg
ctgatcgcccacgcgatggtcgggacgtttctgggtatcctgctggcctatgggtttatc
tccccgctggcttcgctgatgcgccagaagagcgccgaaaccaccaaaatgatgcactgc
attaagacaacgctgctctctagcctgaacggctatgccccgcagatcgcggtggagttt
gggcgtaagacgctgtactccaccgagcgtccgtcgttcattgagctggaagagcacgtg
cgtcaggtgaaaaccccggcgaaacaggcggcaacggaagaagaagtatga

DBGET integrated database retrieval system