KEGG   Edwardsiella piscicida C07-087: ETAC_06340Help
Entry
ETAC_06340        CDS       T02509                                 

Definition
(GenBank) chemotaxis protein CheA
  KO
K03407  two-component system, chemotaxis family, sensor kinase CheA [EC:2.7.13.3]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
etc02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_06340
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    ETAC_06340
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:etc01001]
    ETAC_06340
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:etc02022]
    ETAC_06340
   02035 Bacterial motility proteins [BR:etc02035]
    ETAC_06340
Enzymes [BR:etc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     ETAC_06340
Protein kinases [BR:etc01001]
 Histidine kinases
  CheA family [OT]
   ETAC_06340
Two-component system [BR:etc02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   ETAC_06340
Bacterial motility proteins [BR:etc02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    ETAC_06340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheW CheY-binding Hpt HATPase_c H-kinase_dim HATPase_c_3
Motif
Other DBs
NCBI-ProteinID: AGH73391
Position
1453978..1456086
Genome map
AA seq 702 aa AA seqDB search
MSMDISAFYQTFFDEADELLADMEQHLLALDPQEPDNEQLNAIFRAAHSIKGGAATFGFT
VLQETTHLLENLLDGARRGEMRLSTEIINLFLETKDIMQDQLDAYKSAQDPDADSFEYIC
QALRQLALEAKGEAPAAVAAPAPASAAAPATPVAAASVAPQGGLSISLTGLKAAEIPLML
EELGNLGTVQQHQESDSALDVVLETTVSEDDITAVLCFVLEPEQIHFTRPTADLAPQVSL
EEAALPPAEVVREAPVSAPAPEPTPAPESASAPEPVSAPERATPPDATAAAAPHVPRHNP
RAAKGAENSTSIRVAVEKVDQLINLVGELVITQSMLAQRSNMLDPVDHGDLLNSLGQLER
NARDLQESVMSIRMMPMEYVFSRFPRLVRDLASKLDKQVELTLLGSSTELDKSLIERIID
PLTHLVRNSLDHGIESPQVRQAAGKSTVGNLTLSAEHQGGNIYIEVIDDGAGLNHQKILD
KARSQGMSVHDNMTDEEIGLLIFAPGFSTAEKVTDVSGRGVGMDVVKRNIQEMGGHVEIE
SREGKGTTIRIVLPLTLAILDGMSVKVSNEVFILPLNAVMESLQPNDEDLYPLAGGERVL
QVRGEYLPLVELHRVFDVADAKTDATQGIVVILQSAGRRYALLVDQLIGQHQVVVKNLET
NYRKVPGISAATILGDGSVALIVDVAALQSINREKRVAGAAA
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
gtgagcatggatattagcgcgttttatcaaacgttctttgatgaagcggatgaactgttg
gctgatatggaacagcacctgttggcgctggatcctcaggagccggataacgaacaactg
aacgccatctttcgcgctgcccactcgattaaggggggggcggccactttcggttttacc
gtactgcaggagaccacgcatctgctggagaacctgctcgacggtgcccgccgtggtgaa
atgcggctgagtaccgagatcatcaacctgtttctggaaaccaaagatattatgcaggat
cagctcgatgcctataagtccgctcaggaccccgacgccgatagcttcgaatatatttgc
caggcgctaagacagctggcgttagaggcgaaaggggaggcacctgccgccgtggcagcg
ccggcgcctgcgtcggccgcagcgccggctacgcctgtcgccgcggcgagcgtggcgccg
cagggcggactgtccatctcgttaaccgggctcaaggcggcggaaatcccgctgatgctg
gaggagctgggcaatctgggtacggtacagcagcatcaggagagcgacagcgcgctggat
gtggtgctggagaccacggtcagtgaggacgacattacggcggtgctgtgctttgtgctg
gagccggagcagatccactttacccgcccgacggcggacctcgcgccgcaggtcagccta
gaagaggcggctctgccgcccgccgaggtcgtgcgtgaggcaccggtctctgcgcctgcg
cctgagccgactcccgcgcctgaatccgcctccgcgcctgagcccgtttccgcgcctgag
cgtgcgactccgccggatgcgacggcggccgcggcgccccacgttccgcgccacaacccg
cgcgcggccaaaggggcagagaacagcaccagcatccgcgtcgccgtggagaaggtcgat
cagctgatcaacctggtcggcgagctggtgatcacccagtcgatgctggcgcagcgctcc
aatatgctggatccggtcgatcatggcgatctgctcaacagcctgggccagcttgagcgc
aacgcccgggatctgcaggagtcggtcatgtcgatccgcatgatgccgatggagtacgtc
tttagccgtttcccgcgtctggtgcgtgacctggccagcaagctcgacaagcaggtcgag
ctgacgctgctgggcagctcgaccgaactggataagagcctgatcgagcgcattatcgat
ccgctgactcacctggtacgcaacagcctggatcacggcatcgaatcgccgcaggtgcgt
caggcggcgggcaagagcaccgtcggcaacctgaccctctctgcggagcaccaggggggc
aatatctatattgaggtcatcgacgatggcgccggcctgaaccaccagaagatcctggac
aaagcgcgctcccaggggatgtcggtgcacgacaatatgaccgacgaagagattggcctg
ctgatctttgcgccgggcttctccaccgccgagaaggtcaccgacgtctccgggcgcggc
gtcgggatggacgtggtgaagcgaaatatccaggaaatgggcggccacgttgagatcgag
tcgcgtgaggggaaaggtacgacgatccgtatcgtcctgccgctgaccctggcgattctg
gacggtatgtcggtcaaagtcagcaacgaggttttcattctgccgctgaacgccgtgatg
gagtcgctgcagccgaacgatgaggatctctatccgctggccggcggtgagcgcgtgctg
caggtgcgcggcgaatatctgccgctggtggagctacaccgcgtctttgacgtcgccgac
gccaagaccgacgccactcagggcattgtcgtgattctgcaaagcgccggacgccgctat
gcgctgttggtcgatcagctgatcggtcagcatcaggtggtggtgaaaaacctggaaacc
aactaccgcaaagtgccgggcatctccgcggcaaccatcctcggcgacggcagcgtggcg
ctgatcgtcgacgtcgcggcgctgcagagcattaaccgggaaaaacgggtcgccggcgcg
gccgcctga

DBGET integrated database retrieval system