KEGG   Edwardsiella piscicida C07-087: ETAC_06345Help
Entry
ETAC_06345        CDS       T02509                                 

Definition
(GenBank) purine-binding chemotaxis protein
  KO
K03408  purine-binding chemotaxis protein CheW
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
etc02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_06345
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    ETAC_06345
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:etc02035]
    ETAC_06345
Bacterial motility proteins [BR:etc02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    ETAC_06345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheW
Motif
Other DBs
NCBI-ProteinID: AGH73392
Position
1456156..1456650
Genome map
AA seq 164 aa AA seqDB search
MTGLASVSKLAGETVGQEFLVFTLGDEEYGIDILKVQEIRGYDQVTRIANTPSFIKGVTN
LRGVIVPIIDLRVKFSQQDVSYNDNTVVIVLNFSQRVVGIVVDGVSDVLSLSADQIRPAP
EFAVTLSTEYLTGLGALGERMLILVDIEKLLSSEEMALVDSVTA
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgactggactggcttccgtaagcaaactggcgggtgaaaccgtaggccaggaattcctg
gtatttacgctgggggatgaggagtacgggatcgatatccttaaggtgcaggagatccgc
ggttacgaccaggttacccgtattgccaacacgccctcctttattaaaggggtgactaac
ctgcgcggtgtgatcgtcccgatcatcgatctgcgggtgaagttttctcagcaggacgtc
agctataacgacaataccgtggtcatcgtgctgaacttcagccagcgcgtcgtcgggatt
gtggtggacggcgtctccgatgtgctctccctgagcgcggatcagatccgtccggcgccg
gagtttgcggtaacgctgtcgaccgagtatctgaccggcctcggcgcgctcggcgagcgt
atgctgattctggtagacatcgaaaagctgctcagcagcgaagagatggcgctggtggac
agcgtcaccgcctga

DBGET integrated database retrieval system