KEGG   Edwardsiella piscicida C07-087: ETAC_06350Help
Entry
ETAC_06350        CDS       T02509                                 

Definition
(GenBank) methyl-accepting chemotaxis protein I
  KO
K05874  methyl-accepting chemotaxis protein I, serine sensor receptor
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
etc02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_06350
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    ETAC_06350
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:etc02035]
    ETAC_06350
Bacterial motility proteins [BR:etc02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    ETAC_06350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MCPsignal TarH HAMP Prominin
Motif
Other DBs
NCBI-ProteinID: AGH73393
Position
1456829..1458499
Genome map
AA seq 556 aa AA seqDB search
MLNRIKVVTSLLLVLGLFGILQMTSGGVFFDALKSDKESITVLQTIRQQQAALNGSWVAL
LQTRNTLNRAGIRYMADLNKTGSGATVPDLMQLASAELKEAEQEWERYQGLPRDPRQSDE
AVQAMSQSYDTLHSALGELIQMLTAGRINDFFEQPTQSYQDSFEKAYETYLAQNDSLYHQ
AVTSNNDAYHMALWILLAVMVVVAAAIVLVWMGIHHTLIRPLNSLMGNIRQFAVGDLSGR
IEVCGSNEMGQLADSLRHMQTEFVRTVSDVRQGANAIYSGASEISAGNNDLSSRTEQQAA
SLEETAASMEQLTATVKQNAENARQASQLALSASETAQRGGKVVANVVQTMHDIASSSQK
IADITGVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLAQRSAQAAKEIKGL
IEDSVSKVDTGSVLVESAGDTMGDIVNAVTRVTDIMGEIASASDEQSRGIEQVGQAVSEM
DRVTQQNAALVEESASAAASLEDQASHLNQAVAVFRIEPQGEAEPVVRAAPRSSAAPAPA
KAKASDDSSSDNWETF
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaccgcataaaagtagttaccagtttgctactggtgttggggttatttggcatt
ttgcagatgacttccggaggagtgttctttgacgccctgaaaagcgacaaggaaagtatt
accgttttgcaaaccattcgccaacagcaggccgcgcttaacggcagctgggtggctttg
ctccagacacgcaataccttaaaccgtgccgggatccgctatatggccgatctgaataaa
accggctccggtgccaccgtacccgatctgatgcagctggccagcgccgagctgaaagag
gcggagcaagagtgggagcgctatcagggcttgccgcgcgatccgcgtcagagcgacgaa
gccgtacaggccatgagccaaagctacgatacgctgcacagcgcgctgggcgagctgatc
cagatgctcaccgccggtcggattaacgacttcttcgaacagccgacgcaaagctatcag
gacagctttgaaaaagcctatgagacctacctggcgcagaacgacagcctataccatcag
gccgtgacatcaaataacgacgcctatcatatggcgctgtggatcctgctggccgtgatg
gtggtggtggccgcggcgatcgtgctggtgtggatgggtatccatcacacgctgatccgt
ccgctcaatagcctgatgggcaatatccgtcagttcgccgtcggcgatctctccggtcgc
atcgaggtgtgcggcagcaacgaaatggggcagttggccgatagcctgcgccatatgcag
accgaatttgtccgcaccgtcagcgacgtccgtcagggtgccaatgccatctacagcggc
gccagcgaaatctctgccggaaataacgatctctcctcgcgcaccgagcagcaggcggcc
tcgctggaagaaacggcagccagtatggagcagttgacggcgaccgtgaaacagaacgcc
gaaaacgcccgccaggccagccagctggcgctgagcgcctccgaaacggcccagcgcggc
ggcaaggttgtcgccaacgtcgtgcagaccatgcatgacatcgccagcagctcgcagaag
atcgccgacattaccggggttatcgacggtattgccttccagaccaatattctggcgctg
aacgcggcggtagaggcggcgcgcgccggtgagcaggggcgcggctttgccgtggtggcg
ggcgaggtgcgtaacctggcccagcgcagcgctcaggcggcgaaagagattaaagggctg
attgaagactccgtcagcaaggtcgataccggctcggtattggtcgaaagcgccggcgat
accatgggcgacatcgttaacgcggtgacccgggtgaccgacatcatgggtgagattgcc
tcggcctctgacgaacagagccgcggcatcgagcaggttggtcaggccgtttccgagatg
gatcgggtgacgcagcagaacgccgcgctggtggaagagtccgcctctgccgccgcgtcg
ctggaagatcaggccagccatctgaatcaggccgtcgcggtattccgcattgagccgcag
ggtgaggcggagccggtggttcgcgccgcgccgcgcagcagcgccgctcccgcgccggcg
aaagccaaagcgtcggacgacagcagcagcgataactgggagacgttctga

KEGG   Edwardsiella piscicida C07-087: ETAC_06355Help
Entry
ETAC_06355        CDS       T02509                                 

Definition
(GenBank) Methyl-accepting chemotaxis protein IV
  KO
K05877  methyl-accepting chemotaxis protein IV, peptide sensor receptor
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
etc02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_06355
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    ETAC_06355
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:etc02035]
    ETAC_06355
Bacterial motility proteins [BR:etc02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    ETAC_06355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MCPsignal TarH HAMP 4HB_MCP_1 RIFIN DUF4200
Motif
Other DBs
NCBI-ProteinID: AGH73394
Position
1458647..1460239
Genome map
AA seq 530 aa AA seqDB search
MFNRIRISTSLFALVLAFCFLQLSSNGVSFMAIRSDSDNYARVQISNDQRETLGQTWVAL
LQARNTLNRAGTRAALHIPQDQIDALMHRVRAMLKKADDSMQQYMACSDSDEEDRALSQE
ALQHYQALRTALLQLVSLLEKGDLQGFMDQPTQRIQDQFEASVAKLTQHVEGELKQGAEI
NRNSYHLSMALNLAAVVLLALVMLIAIWWLRNMLLAPLTVMRAHFERIARGDLSAEIKVY
GRNEISQLYASLRNMQQALAGTVLSVRQGTDAIYTGLQEIGAGNNDLSSRTEQQAASLEE
TAASMEQLTATVKQNADNARQASQLAQEASHTAGEGGEIVSQVVRTMHDITQSSQKIGDI
TGVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLAQRSAQAAKEIKGLIDES
VSRVKQGSTLVESAGNTMDNVVRSVVRVTDIMGEISSASEEQSRGIEQVAQAVTQMDQVT
QQNAALVEEAASATQSLEAQADVLSRAVATFRLSGDAAQTDLQGQANGTS
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
gtgtttaaccgaatccgcatatcgaccagtttgtttgcgttggtgctggcattctgcttt
ttgcagctgtcatccaacggggtgtcgtttatggccatccgatctgacagtgataactat
gcccgggtacagatatccaacgatcagcgcgaaacgctggggcaaacctgggttgccctg
ctgcaggcgcgcaacacgctgaaccgcgccggtacccgcgcggcgctgcatatccctcag
gatcagatcgatgcgctgatgcaccgcgtgcgcgccatgctgaaaaaggccgatgactcg
atgcagcagtatatggcctgctcagacagcgatgaggaagatcgcgcgctgtctcaggag
gcgctgcagcactatcaggcgctgcgcacggcgctgctgcagctggtctctctactcgag
aagggagacctgcaggggtttatggaccagccgacccagcggatccaggatcagtttgaa
gccagcgtggcgaagctgacgcagcacgttgagggcgaactgaagcagggcgccgagatc
aatcgcaactcctaccacctctccatggcgctgaatctggcggccgtggtgctgctggcg
ctggtgatgctgatcgctatctggtggctgcgcaatatgctgctggcgccgctgaccgtc
atgcgcgcgcactttgagcgcatcgcgcgcggcgatctgtcggcggagatcaaggtgtat
ggccgtaacgagatcagccagctgtatgccagcctgcgtaacatgcagcaggctctggcc
gggacggtgctgtcggtacgccaggggacggacgccatctataccgggctgcaggagatc
ggcgccggtaacaacgacctctcttcgcgcaccgagcagcaggcggcctcgctggaagag
acggccgccagcatggaacagctgaccgccacggtgaaacagaacgccgacaacgcccgc
caggcgtcgcagctggcgcaggaggcctctcataccgccggtgaaggcggcgagatcgtc
agccaggtggtgcggactatgcatgatattacgcaaagttcgcaaaagattggcgatatc
accggcgttatcgatggcatcgctttccagaccaatattctggcgctgaacgcggcggta
gaggcggcgcgcgccggagagcaggggcgcggctttgcggtggtcgcgggtgaagtgcgc
aatctggctcagcgcagcgcccaggcggcgaaagagatcaaagggctgatcgacgagtcg
gtcagccgggtaaaacaggggtcaaccctggtagagagcgccggaaataccatggataac
gtggtgcgttcggtggtgcgggtgaccgatatcatgggcgaaatcagctccgcatcggag
gagcagagccggggcattgagcaggtcgcccaggcggtaacgcaaatggatcaggtgacg
cagcagaacgccgcgctggtagaagaagcggcatcggcaacccagtctttggaagcgcag
gccgatgtcctgtcgcgcgccgtcgccacgttccgtctgagcggcgatgcggcgcagacc
gacctgcaagggcaagccaacggcacgagctga

KEGG   Edwardsiella piscicida C07-087: ETAC_07975Help
Entry
ETAC_07975        CDS       T02509                                 

Definition
(GenBank) methyl-accepting chemotaxis protein
  KO
K03406  methyl-accepting chemotaxis protein
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
etc02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_07975
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    ETAC_07975
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:etc02035]
    ETAC_07975
Bacterial motility proteins [BR:etc02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    ETAC_07975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MCPsignal dCache_1 HAMP Mod_r
Motif
Other DBs
NCBI-ProteinID: AGH73716
Position
complement(1814013..1815803)
Genome map
AA seq 596 aa AA seqDB search
MFDSIRARILATTGVIVAASLCVNTLINYRIASDSNAEVIQHTLSSLTASHTATVRQWVE
NNTALIASLTPHVGDSDPRPLLKQIADAGGFISVDMGYSNKVEISSDPASIPPGFDPTTR
AWFINARKAGHPIVTEPYMDANTHTLVVTFAAPGPQDTPISGVVEGDVHMDKVIANVRSI
RPTENSFGMLLNADGTIIAHPNQQLTLKPLANIAPGLSLTQLLTSGKPVEATVSGRDVLL
LAMPVSGTSWYTVVAMDKTEATAGMRSLLLASCIALLVLIVLATLVIGIVTRRALRPLFH
IRQAMENIGAGNNADLTKRLDVQGKDEVSQIARAFNQFVDKLARVMVSIHSTSESVRIAA
REIAAGNEDLSSRTESAAASLQQTSAALEQISSTVAQSATSAQQANEAVSSAVQVAQRGG
KMISQVIETMSSIEVASGKIGDITGVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAG
EVRTLAQRSAQAAKEIKNLIDSTVTSVASGSHQVRQSGETMTDIVNSVGAVSAIMGEITN
AAEEQNRGISEINSAVIQLDTMVQQNAALVEESTAASAALQGQASELADTVGQFRM
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgttcgattccattcgggcacggatcctcgcgacaaccggcgtcattgtcgcggcgtcg
ctttgtgtcaatacgttgattaattaccgcattgccagcgactccaacgcagaagtcatt
caacataccctaagctctttaaccgctagccataccgccaccgtacgtcagtgggtggaa
aacaacacggcgctgatcgcgtcgctgacgccccacgtgggggacagcgatccccggccg
ctcttaaagcagatagccgacgccggtggctttatcagcgtggatatggggtactccaac
aaggtggagatctcctccgatcccgccagcattcctccgggcttcgatcccacgacccgc
gcctggtttatcaatgccagaaaagcagggcatccgatcgttaccgaaccgtatatggat
gcgaatacccataccctcgtggtaacctttgccgcgcccggcccacaggacacgccgatc
agcggcgtcgtcgagggcgatgtacacatggataaagtgattgccaacgtgcgatccatc
cgccccacggaaaacagctttggcatgctgctcaacgctgacggaaccattattgctcac
cccaatcagcagctaacgctgaagccgctggccaatatcgcgccaggcctgagcctgacc
cagctgttaacctccggcaaacccgtagaggcgaccgtttccggccgtgatgtactgctg
ctggcgatgccggtctctggaaccagctggtataccgtcgtggccatggataagacagag
gccacggccggaatgcgttcgctgctgctggcctcctgtattgcactgttggttctgatc
gttctcgccacgctggtgatcggcatcgttacgcgtcgagcgctgcgtccgctgttccat
atccgccaggcaatggaaaacatcggcgccggcaacaacgcggatctgaccaagcgattg
gatgtgcagggcaaagatgaggtctcgcagatcgcccgcgcatttaaccagttcgtggat
aagctggcccgggtgatggtctctattcacagcaccagtgaatcggttcgcattgccgcg
cgggaaatcgccgcgggcaacgaagatctctctagtcgaaccgagtcagcggcggccagc
ctgcagcagacctcggcggcgttggagcagatctcttccaccgtcgcgcagtcggcgacc
tctgcccagcaggccaatgaggccgtcagctctgccgttcaggtagcgcagcgcggtggc
aagatgatctcgcaggtcattgaaaccatgtcttcgattgaggtcgcctccggtaaaatc
ggcgacatcaccggggtcatcgatggcattgcattccaaaccaatatactggcgctcaac
gccgcggttgaagccgctcgcgcgggcgagcaggggcgtggatttgccgttgtcgccggc
gaggtcagaacgctggcccagcgcagcgcccaggcagccaaagagatcaaaaatctgatc
gactcaaccgtgaccagcgtcgcctccggctcacatcaggtacgccaaagcggtgaaacc
atgacggatattgtgaacagcgtcggcgccgtcagcgccatcatgggtgagataaccaac
gcggcggaagagcaaaaccgcggcatcagtgagatcaacagcgcagtgatccagctggat
acgatggtgcagcagaacgccgccctggttgaggagtcaaccgcggcctccgccgcgctg
caagggcaggcgagtgagctggccgataccgtaggtcagttccgcatgtag

KEGG   Edwardsiella piscicida C07-087: ETAC_10830Help
Entry
ETAC_10830        CDS       T02509                                 

Definition
(GenBank) Methyl-accepting chemotaxis protein I
  KO
K05874  methyl-accepting chemotaxis protein I, serine sensor receptor
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
etc02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_10830
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    ETAC_10830
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:etc02035]
    ETAC_10830
Bacterial motility proteins [BR:etc02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    ETAC_10830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MCPsignal HAMP TarH Amastin DUF4510 Vps53_N
Motif
Other DBs
NCBI-ProteinID: AGH74287
Position
complement(2459008..2460441)
Genome map
AA seq 477 aa AA seqDB search
MFFSDAWINLVQARSTLREAQNQAIAATVDRERMKGLFSRADRRIAEARSNYVAYKDIPD
VDGLDMNVVNRVNNDFTKYLSTVSKIAELLKQNDIPRAAELNQQLISLNIETQHAYNLWQ
EEHDRLMEVGVQNSHHASQIMKWVLLLLALLSLLCLLLCWVSVKQAMLIPLQSIIRSVQR
IAQGDLTQRFQRHGKSEMGILAAHIDDMQRALREIVASVRHSASAIYSGAGEIASGGSNL
ASRTEEQAAALEETAASMEQMTSIVDKNTDSSRYVAQLAGEATHTAESGGLAIAEVVKTM
EEIAGNSKHIASITNVIDSIAFQTNILALNAAVEAARAGDQGRGFAVVASEVRSLAQRSA
QAAKEINTLIASSVERVNQGSVNVSAAGATMANIISAITHVSGLIGEISSSAEEQSRGIA
QINQAINQMDTVTQHNATLVEESTAASHGLEGQAKALTEIVAAFNVSDAAALAPAAA
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgttttttagcgacgcatggatcaacctggttcaggcgcgctccacgctgagagaggca
cagaatcaagctattgcagcgacggtcgatcgggagcggatgaaggggctcttctcccgc
gccgatcggcggattgccgaagcacgcagtaattatgtggcttataaagatattcccgac
gttgacgggctggatatgaatgttgtcaatcgggtaaataatgacttcacgaaatatctt
tccacggtgtctaaaatagctgaactgcttaagcagaatgatattccacgcgccgcggag
ctgaatcaacagcttatttccctgaatattgaaacacagcatgcgtataatctatggcag
gaagagcatgatcgattaatggaggtcggggtgcagaacagccatcacgccagccagatc
atgaagtgggtgctgctgctgctggcgctgctgtcgctgctgtgcctgttgctgtgctgg
gtgtcggtcaagcaggcgatgctgataccgctgcagagcatcattcgcagcgtacagcgc
attgcgcagggcgatctgacgcagcgctttcagcgccatggcaagagtgagatggggatc
ctggccgcgcatatcgacgatatgcagcgggcgctgcgggagatcgtcgcgtcggtgcgc
catagcgccagcgccatctactccggcgccggagagattgcctctgggggcagcaatctg
gcctcacgcaccgaggagcaggccgctgcgctggaggagaccgctgcgagcatggagcaa
atgacctccattgtcgataagaataccgatagctcacgctacgtggcgcagctggccggc
gaagcaacccatacggcggagtccggtggactggccatcgcggaggtggtcaagaccatg
gaggagatcgccggcaactcgaaacatatcgcctccattaccaatgttatcgatagtatt
gctttccagaccaatatactggcgcttaacgccgcggtggaggcggcgcgggccggcgat
cagggacgcggcttcgccgtcgtggccagtgaggtgcgcagtctggcgcagcgcagcgcc
caggcggcgaaggagatcaatacgctgatcgcctcgtcggtggagcgggtcaatcagggc
agcgtcaatgtgtcggcggccggcgccaccatggcgaatatcattagcgccattacgcac
gtatccggtctgatcggggagatatcgtcgagcgcagaggagcagagccgtgggattgcc
cagatcaaccaggctatcaaccagatggatacggtgacacagcataacgccacgctggtg
gaggagtccacggcggcctcccatgggctggagggacaggccaaggcgttgaccgagatc
gtggcggcgttcaacgtcagcgatgcggcggcgctagcgcccgcggcggcttag

KEGG   Edwardsiella piscicida C07-087: ETAC_12130Help
Entry
ETAC_12130        CDS       T02509                                 

Definition
(GenBank) methyl-accepting chemotaxis sensory transducer
  KO
K05874  methyl-accepting chemotaxis protein I, serine sensor receptor
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
etc02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_12130
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    ETAC_12130
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:etc02035]
    ETAC_12130
Bacterial motility proteins [BR:etc02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    ETAC_12130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MCPsignal TarH HAMP 60KD_IMP zf-C4H2 DUF948 DUF3341 EzrA DUF3450 DUF848
Motif
Other DBs
NCBI-ProteinID: AGH74547
Position
2734147..2735781
Genome map
AA seq 544 aa AA seqDB search
MAVLALFCGLQIFSGIWSLRDASSTDTRLDQISSGFNQIMAMDRAYASITQIREEIMKDA
LALSAHSDEGNARVSLGNLLQKLGNVDKEMENFYSLSLSSGHDNGRAEKVRGLYGKARAD
LVSMIECLQSNDIAGFQSVLKNHSSSGFMSSLDEASDYVANQIISPASQAAAANYRQMIP
LTIGFMILFLAMTALVLYWVRNHIIARIQQVIAYQAEIAHGNLAIDIQARGDNEVSQLMQ
GLRHMRDELAHMVGAVRAGTQNIFTGVQEIAAGNNDLSSRTEEQASSLEETASSMEQISS
TVKNNADSAREATDLVQKASTIAVNGGKITRQMVSTMTEIAESSRKIGDITGVIDGIAFQ
TNILALNAAVEAARAGEQGRGFAVVAGEVRNLAQRSAQAAKEIKGLIDTSVTRVDQGNQL
VENVSHAMEEIVTSVNHISDTMQEISSASEEQSRGIAQIALAINEMDKVTQQNAALVEQS
AAAAGALEDQADRLNQTVSQFRTNDQEEKAPVSAKPVAAPATPAPSAKAAAASRSDDDAN
WDQF
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atggccgttctggccctgttctgcggcctgcagatcttttccggcatctggagtctgcgc
gatgcctccagcaccgacacccgcctcgatcaaatctccagcggcttcaaccaaattatg
gcgatggaccgcgcctatgcctccattacccagatccgcgaagagatcatgaaggatgcc
ctggcgctgagcgcccacagcgatgagggcaacgcccgcgtctccctcggcaacctgctg
cagaagctcggcaacgtcgataaagagatggagaacttctacagcctctccctcagcagc
ggccacgataacggccgcgccgaaaaagtacgcggtctgtatggcaaagcgcgcgccgat
ctggtctcgatgatcgaatgcctgcagagcaacgatatcgccggctttcagagcgtgctg
aaaaaccactccagcagcggctttatgtcctctctggatgaggcctccgactacgtcgcc
aaccagatcatcagcccggcctcccaggcagcagcggccaactaccgccagatgatcccg
ctgaccatcggctttatgatcctgttcctggcgatgaccgccctagtgctgtactgggtg
cgtaaccacatcatcgcccgtatccagcaggtgatcgcctatcaggccgagattgcccac
ggcaacctggccatcgatattcaggcgcgcggcgataacgaagtcagccagctgatgcag
gggctgcgccatatgcgcgacgagctggcccacatggtcggcgcggtacgcgccggcacc
cagaatatctttaccggcgtgcaggagattgccgccggcaacaacgacctctccagccgt
accgaggagcaggccagctcgctggaggagaccgcctccagcatggagcagatctccagc
acggtgaaaaacaacgccgacagcgcccgcgaggccaccgacctggtgcagaaggcctca
accatcgccgtcaacggtggaaagatcacccgtcagatggtcagcaccatgaccgaaatt
gccgaaagttcacgtaaaattggcgatattaccggcgtaatcgacggcatcgccttccag
accaacatcctggcgctgaacgccgcggtcgaagccgcccgcgccggtgagcagggacgc
ggcttcgccgtcgtcgccggcgaagtgcgcaacctggcgcagcgcagcgcgcaggctgcc
aaagagatcaaggggctgatcgacacctcggtaacccgagtcgatcagggcaatcagctg
gtggaaaacgtcagccatgcgatggaagagatcgtcacctccgtgaaccacatctccgac
accatgcaggagatctcctctgcctccgaagagcagagccgcggcattgcccagatagca
ctggcgatcaatgagatggataaggtaacccagcagaacgccgccctggtggagcagtcc
gccgccgccgccggcgcgctggaggatcaggccgaccgcctgaaccagaccgtttcccag
ttccgcaccaacgaccaggaagagaaggcgccggtcagtgccaagcccgtcgccgcaccg
gcgacgccggcgccgtccgccaaggcggccgcggcctcccgcagcgacgacgacgccaac
tgggatcagttctaa

KEGG   Edwardsiella piscicida C07-087: ETAC_16075Help
Entry
ETAC_16075        CDS       T02509                                 

Definition
(GenBank) methyl-accepting chemotaxis sensory transducer
  KO
K03406  methyl-accepting chemotaxis protein
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
etc02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_16075
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    ETAC_16075
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:etc02035]
    ETAC_16075
Bacterial motility proteins [BR:etc02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    ETAC_16075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MCPsignal TarH HAMP IL28A DUF4335
Motif
Other DBs
NCBI-ProteinID: AGH75336
Position
complement(3633036..3634628)
Genome map
AA seq 530 aa AA seqDB search
MFKNVRVITGIIVLLAIFTLLQGLSGRLFYTAIAQDRDNFSQSRALSYQQEQLADGWQTL
VMTRVTINRVAIRYLKQQNAGVAQAEIGPLLDAANASLDSAEGYFKNYRAAPRLPGQDAA
LAAEVERRFTALYSLLRDSSRYLRAGDYPAYGNLETQAAQDAMAEIYAQWRAQNHGLLQQ
GIDANQRSFERMVWTLAGIALAVVLLIILAGAAARGILLRPLAQLHAHLRRLTAGDLSAT
LAGGRNELGSLARSISEMQQALISIVGQVRGGADALLHGSGDITVGNADLSSRTEQQAAA
LEETAASMEQLTATVRQNADNARQASQLASSASATADQGGTEVGQVVTTMGEIADSSRKI
ASITGVIDSIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRSLAQRSAQAAREIRTLI
EDSVRRIDTGSQQATQAGETMQSVVGAAQRVTGIIAEIAAASDEQSLGIAQVSQAVSEME
QVTQQNAALVQQSAASATSLEERACGLSQAVALFTLPGDSTGSDARATTA
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaaacgtcagggttattacggggattatcgtcttattggctatatttaccctg
ctacagggactttccgggcgtctgttctatacggcgattgcgcaggatcgggacaacttc
tcgcagtcgcgagcgctgagctatcagcaggagcagctggccgatggctggcagacgctg
gtgatgacgcgagtgaccattaaccgggtcgcgatccgctacctgaagcagcaaaatgcc
ggggtggcgcaggctgaaatcggcccgttgctggatgcggcgaacgcttcgctggacagc
gccgaaggctacttcaaaaactaccgcgccgcgccgcggctgcccgggcaggacgccgcc
ctcgcggcggaggttgagcgtcgtttcacggcgctgtatagcctgctgcgcgattcctcg
cgctatctgcgcgccggcgactatccggcctacggcaatctggaaacccaggcggcgcag
gatgccatggcggagatttatgcgcagtggcgcgcccagaatcatggcctgctgcagcag
gggatcgacgccaaccagcgcagctttgagcgcatggtgtggacattggccgggatcgcg
ctggcggtcgtgctgttaatcatcctggccggggcggcggcgcgcgggatcctgctgcgg
ccgctggcccagctgcacgcgcatttgcgccgcctgaccgccggcgatttgtcggcgacg
ctggcgggcgggcgcaacgagctggggagcctggcgcgcagcatcagcgaaatgcagcag
gcattgatttcgatcgtcggccaggtgcgcggcggtgccgatgccctgctgcacggcagc
ggtgacattaccgtcggcaatgcggatctgtcgtcgcgcaccgagcagcaggcggcggcg
ctagaggagacggccgccagtatggagcagttaacggccacggtgcgtcagaatgccgat
aacgctcgccaggctagccagctggccagcagcgcctccgcgacggcggatcagggcggg
acagaggtcggccaggtcgttacgacgatgggcgaaatcgccgacagctcacgtaaaatc
gccagcattaccggggtgattgactccattgccttccagaccaatattctggcgctcaat
gcggcggtagaggcggcgcgcgccggagagcaggggcgcggctttgccgtggtggccggc
gaggtgcgcagcctggctcagcgtagcgcccaggcggcgcgtgagatccgcacgctgatc
gaggattcggttcggcgcatcgataccggttcccagcaggcgacgcaggcgggagagacg
atgcagtcggtggtcggggccgctcagcgggtcaccgggattattgccgagatcgcggcg
gcttctgacgaacagagcctggggatcgcgcaggtgagtcaggcggtaagcgagatggag
caggtcacccagcagaacgccgcgctggtgcagcagtccgccgcgtccgccacatcgctg
gaggagcgggcctgcggcctgtcccaggcggtggctctctttaccctgccgggggacagc
accggcagcgatgccagagctaccacggcctaa

DBGET integrated database retrieval system