KEGG   Edwardsiella piscicida C07-087: ETAC_06360Help
Entry
ETAC_06360        CDS       T02509                                 

Definition
(GenBank) chemotaxis methyltransferase CheR
  KO
K00575  chemotaxis protein methyltransferase CheR [EC:2.1.1.80]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
etc02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_06360
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    ETAC_06360
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:etc02035]
    ETAC_06360
Enzymes [BR:etc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     ETAC_06360
Bacterial motility proteins [BR:etc02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    ETAC_06360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheR CheR_N Methyltransf_25 Methyltransf_12 Methyltransf_11 Methyltransf_23
Motif
Other DBs
NCBI-ProteinID: AGH73395
Position
1460296..1461171
Genome map
AA seq 291 aa AA seqDB search
MTNLLLQAAQGENNVSSLAMQRLTLGDAHFRRISQLIYQRAGIVLADHKREMVYNRLVRR
LRALNLSDFGDYLALLESHPESDEWQTFVNSLTTNLTAFFREAHHFPILAEHARARRHNY
CVWSTAASTGEEPYSIAMTLAEALGPSPMAPQVWASDIDTQVLEKAQRGIYRQEEAKLLN
ATQLQRFFLRGTGPHQGLIRVRHELAQRVHFQMLNLLEAKWDLPGPFDAIFCRNVMIYFD
KQTQARILRRFIPLLKPGGLLFAGHSENFSQISRDFHLRGQTVYGLTKESR
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatttattactacaggcagcacagggggaaaacaacgtctcctcactggcaatg
caacgtctgacgttgggggatgcccattttcggcggattagccagttgatttaccaacgg
gccggtatcgtacttgccgaccataaacgtgaaatggtttacaaccggctggtgcgtcgc
ttacgggcgttgaatctgagcgactttggcgactatctggcgctgctggagagtcacccg
gagagcgatgagtggcaaacctttgtcaactcgctgaccactaacctgaccgccttcttt
cgcgaggcgcatcacttcccgattctggcggagcatgcgcgcgcgcggcggcacaactac
tgtgtctggagtacggcggcctccacgggcgaggagccttactcgatcgcgatgaccctg
gctgaggcgctggggccatcgccgatggcgccgcaggtgtgggccagcgacatcgataca
caggtgctggaaaaggcgcagcgcggtatctaccgccaagaggaggccaagctgctgaac
gccacgcagctgcagcgcttttttctgcgcggcaccgggcctcatcaggggctgatccgg
gttcgccatgagctggcgcagcgggtgcatttccagatgctgaacctgctggaggctaag
tgggatctgccgggcccattcgatgcgattttttgtcgtaacgtaatgatctatttcgat
aaacaaacgcaggctcgcattctgcgtcgttttatccccttgttaaagccgggtggcctg
ctgtttgccggtcattcggagaacttcagccagatctcccgcgatttccatctgcgcggg
cagaccgtttatgggctgacgaaggagagccgatga

DBGET integrated database retrieval system