KEGG   Edwardsiella piscicida C07-087: ETAC_06365Help
Entry
ETAC_06365        CDS       T02509                                 

Definition
(GenBank) chemotaxis-specific protein-glutamate methyltransferase
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
etc02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_06365
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    ETAC_06365
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:etc02022]
    ETAC_06365
   02035 Bacterial motility proteins [BR:etc02035]
    ETAC_06365
Enzymes [BR:etc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     ETAC_06365
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     ETAC_06365
Two-component system [BR:etc02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   ETAC_06365
Bacterial motility proteins [BR:etc02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    ETAC_06365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest Response_reg
Motif
Other DBs
NCBI-ProteinID: AGH73396
Position
1461168..1462220
Genome map
AA seq 350 aa AA seqDB search
MNKIRVLCVDDSALMRQLMTEIVNSHPDMEMVAAAQDPLVARDLIKKFNPQVLTLDVEMP
RMDGLDFLEKLMRLRPMPVVMVSSLTGKGSEITLRALELGAVDFVTKPQLGIREGMLAYS
ELIADKIRTAARARLPRQLKQSEPPATLSHGPLLSSEKLIAIGASTGGTEAIRHVLQPLP
PTSPALLITQHMPPGFTRSFAERLNKLCQITVKEAEDGERILPGHAYIAPGAHHLELARS
GANYIVRLHQGPPVNRHRPSVEVLFDSVARCAGRNAVGVILTGMGNDGAAGMLRLHQAGA
YTIAQNEASCVVFGMPREAIQMGGVDEVVDLSQISQRMLAQVSAKQALRI
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagatccgggtattgtgcgtggatgactccgcgctgatgcgccaactgatgacc
gagatcgtgaacagccaccccgatatggagatggtggccgccgcgcaggacccgttggtc
gcgcgggatctgatcaaaaaattcaatcctcaggtgctgacactggatgttgaaatgccg
cgcatggacggcctcgactttttggagaaactgatgcgcctgcgcccgatgccggtggtg
atggtctcttccctgaccgggaaggggtcggagatcaccctgcgggcgctggagctgggc
gcggtggactttgtgaccaagccgcagctggggatccgcgaggggatgctggcctatagc
gagctgatcgccgataagatccgcaccgccgcgcgcgcgcgtctgccgcgccagctgaag
cagagcgagccgccggcgaccctcagccacggcccgctgctcagcagcgaaaagctgatc
gccatcggcgcctctaccggcggcaccgaggcgattcgccacgtgctgcagccgctgccg
ccgaccagcccggcgctgctgatcacccagcatatgccgccgggctttacccgctctttt
gccgagcggctgaacaagctgtgccagatcacggtgaaagaggccgaggatggcgaacgt
atcctgccgggacatgcctatattgcccccggcgcccaccatctggagctggcgcgcagc
ggtgccaactatatcgtgcgtctgcatcaggggccgccggtgaaccgtcatcgcccctct
gtcgaggtgctgtttgactccgtcgcccgctgcgccggccgcaacgccgtcggagtgatc
ctgacgggaatgggcaacgacggcgccgcggggatgctgcgactgcaccaggcgggcgcc
tataccattgcgcaaaatgaagccagctgcgtggtctttggtatgccgcgcgaggcgatt
cagatgggcggggtcgacgaggtggtcgatctctcccaaatcagccagcgtatgctggcg
caggtcagcgccaagcaggcgctgcgtatttaa

DBGET integrated database retrieval system