KEGG   Edwardsiella piscicida C07-087: ETAC_06370Help
Entry
ETAC_06370        CDS       T02509                                 

Definition
(GenBank) chemotaxis regulator transmitting signal to flagellar motor component
  KO
K03413  two-component system, chemotaxis family, chemotaxis protein CheY
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02020  Two-component system
etc02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_06370
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    ETAC_06370
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:etc02022]
    ETAC_06370
   02035 Bacterial motility proteins [BR:etc02035]
    ETAC_06370
Two-component system [BR:etc02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   ETAC_06370
Bacterial motility proteins [BR:etc02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    ETAC_06370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg BRCT_3 PliI
Motif
Other DBs
NCBI-ProteinID: AGH73397
Position
1462316..1462705
Genome map
AA seq 129 aa AA seqDB search
MADKNLRFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGADALSKLRAGGFDFVVSDWNM
PNMDGLQLLQAIRADGTLNKMPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKL
NKIFEKLGI
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atggcggataagaatctgcgttttctggttgtcgatgatttctctaccatgcgtcgtatt
gtacgcaatctgttgaaagagctgggattcaacaacgtagaggaagccgaagacggcgcc
gatgcgctgagcaagctgcgcgccggcggattcgactttgtggtatctgactggaacatg
ccgaacatggacggtctgcagctgctgcaggcgatccgcgcggacggcacgctgaacaag
atgccggtcttgatggtaacagccgaggcgaagaaagagaacatcatcgccgccgcgcag
gcaggggccagcggctacgtggtgaagccgtttaccgccgcaacgctggaagaaaaactg
aataagatttttgaaaagctcgggatctaa

DBGET integrated database retrieval system