KEGG   Edwardsiella piscicida C07-087: ETAC_06420Help
Entry
ETAC_06420        CDS       T02509                                 

Definition
(GenBank) membrane-associated phospholipid phosphatase
  KO
K09474  acid phosphatase (class A) [EC:3.1.3.2]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00740  Riboflavin metabolism
etc01100  Metabolic pathways
etc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    ETAC_06420
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ETAC_06420
Enzymes [BR:etc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.2  acid phosphatase
     ETAC_06420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PAP2
Motif
Other DBs
NCBI-ProteinID: AGH73407
Position
complement(1470802..1471530)
Genome map
AA seq 242 aa AA seqDB search
MLFIGYRHRLLLISTALLLAGQVFAAGHDVYLTPQSAPNAVKILPPPPGYDSVAFLQDKA
VYQSTGAVYDAKRVEQAARDGNYKAIPELFSPAFGMPISDAATPAIYRLLSNMMADSHNP
TLRSAKNHYMRQRPFVFYHGQTCTPQYDKEMAGSGSYPSGHATLGWAVALVLAEINPARQ
DALLQRGYQFGQSRVICGAHWQSDVDQGRLLGSAFVASLHAQPQFERDLAAAKAEFARLH
QR
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgttgtttatcggctataggcaccggctactgcttatctctaccgcgctactgctggcc
ggtcaggtcttcgccgccggccatgacgtctacctgacaccgcagagcgccccgaacgcg
gtcaagatactgccgccgccgccgggctatgactccgtcgcctttttgcaagataaggcc
gtctaccagtcgaccggcgccgtctatgatgccaaacgcgtcgagcaggccgcccgcgac
ggtaactacaaggcgatccctgagctgttctctcccgccttcggcatgcccattagcgac
gcggcgacgccggcgatctaccgcctgctcagcaatatgatggcggacagccacaacccg
accctgcgctccgccaagaatcactatatgcgccagcgcccgttcgtcttctaccacggg
cagacctgtacgcctcagtatgataaggagatggctggctccggctcctacccctccggc
catgccacgctgggctgggcggtggcgctggtgctggcagagatcaatcctgcccggcag
gacgcgctgctgcagcgcggctaccagtttggtcagagccgggtgatctgcggcgcacac
tggcaaagcgacgtcgaccaggggcgcctgctgggctctgcgtttgtcgccagcctgcac
gctcagccgcagtttgagcgcgacctggccgccgcaaaggccgagttcgcacggctgcac
cagcgctaa

DBGET integrated database retrieval system