KEGG   Edwardsiella piscicida C07-087: ETAC_06465Help
Entry
ETAC_06465        CDS       T02509                                 

Definition
(GenBank) catalase
  KO
K03781  catalase [EC:1.11.1.6]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00380  Tryptophan metabolism
etc00630  Glyoxylate and dicarboxylate metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01130  Biosynthesis of antibiotics
etc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    ETAC_06465
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    ETAC_06465
Enzymes [BR:etc01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     ETAC_06465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Catalase Catalase-rel
Motif
Other DBs
NCBI-ProteinID: AGH73416
Position
complement(1483033..1484214)
Genome map
AA seq 393 aa AA seqDB search
MHGTHSPETLRDPRGFATKFYTAEGNWDLVGNNFPTFFIRDAIKFPDMVHAFKPDPRTNL
DNDARRFDFFSHLPESTRTLTLLYSNEGTPLSYRNMDGNSVHAYKLINDKGEVHYVKFHW
KTRQGIKNLDPQQVEQIQGKDYSHMTQDLVTAINRGDYPKWDLYIQVLKPADLKNFDFDP
LDATKVWPDVPERKIGEMVLNKNPDNVFQETEQVAMAPSNLIPGIEPSEDKLLQGRLFAY
ADTQFYRIGANGLSLPINKPHSVVNNGNQDGQLNSGHTLDKGVNYQPSRIYPREELVSSR
YSQTPLSGTTQQSKIQREQNFKQAGELYRSYSKKEQNDLINSLGTSLASADTVSKNIMLS
YFYKADKDYGTRLTSVANGDLPTVKNLADKLQD
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
gtgcatggaacccactcgccggaaaccctgcgcgatccgcgtggctttgcgacaaaattt
tatactgccgagggtaactgggacttggtaggcaataacttccccaccttctttattcgt
gatgcaatcaagttcccggatatggtgcatgcgtttaagcccgatccccggacaaatctt
gataatgatgcgcgacgctttgattttttctcacacctgcctgagtcaacgcggaccttg
accttgctctactctaacgagggtacgccgctatcctatcgcaatatggacggtaacagc
gtacatgcctataagctgattaatgacaaaggcgaagtccactatgtgaagtttcactgg
aaaacgcgccaagggatcaagaatctggacccacagcaggttgaacagattcaaggtaaa
gattatagccatatgacgcaggatctggtgacggcaatcaaccgtggcgactatccaaaa
tgggatctgtacatccaggttctcaagcccgccgacctaaaaaacttcgatttcgatccg
cttgatgccacgaaggtctggccagatgtgcctgagcgaaaaattggcgaaatggttctt
aacaaaaaccctgataacgttttccaagagaccgagcaggtggcgatggcgccctcaaac
ctcatcccgggcattgaaccatcggaagataagctactgcaagggcgcctgttcgcctat
gccgatacacaattttaccgtatcggcgccaatggacttagcctaccgataaacaagcct
catagcgtggtcaataatggcaaccaggatgggcaactcaacagtggacatacgctagac
aaaggggttaactaccagccaagccgtatttacccgcgggaagagttggtctccagccgt
tatagccagacgcccctgtcaggcaccacgcagcaaagtaaaatccagcgcgagcaaaat
ttcaaacaggcgggagagctttatcgctcgtacagtaaaaaagagcaaaatgacctcatc
aatagcctgggaacctccctggctagcgctgacactgtcagtaaaaacattatgttatcc
tatttttataaagcggataaggactacggcactcgccttaccagcgtcgctaacggtgat
ttgccaacggtaaaaaacttggcggataagctccaagattaa

DBGET integrated database retrieval system