KEGG   Edwardsiella piscicida C07-087: ETAC_06500Help
Entry
ETAC_06500        CDS       T02509                                 

Gene name
nikE
Definition
(GenBank) nickel transporter ATP-binding protein NikE
  KO
K10824  nickel transport system ATP-binding protein [EC:7.2.2.11]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02010  ABC transporters
Module
etc_M00440  Nickel transport system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_06500 (nikE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_06500 (nikE)
Enzymes [BR:etc01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.11  ABC-type Ni2+ transporter
     ETAC_06500 (nikE)
Transporters [BR:etc02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Nickel transporter [MD:M00440]
    ETAC_06500 (nikE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_22 AAA_16 AAA_21 RsgA_GTPase Sigma54_activat MMR_HSR1 DUF4388 SMC_N AAA_5 IstB_IS21 AAA_29 DUF87 AAA_25 AAA_18 SbcCD_C NB-ARC G-alpha NACHT
Motif
Other DBs
NCBI-ProteinID: AGH73421
Position
complement(1491375..1492187)
Genome map
AA seq 270 aa AA seqDB search
MSLLSTQTLSHRYRHAALGRQAQQVLQAISLQLHRGESVALLGRSGCGKSTLARLLVGLE
QPTQGVVCWHDTPLSQLDRRAKKAFRRDIQLVFQDAIGAVDPRQTVRAILREPMRHLLSL
SPAEQRVRAGEMLRAVELDEGVLDQRPPQLSGGQLQRVCLARALVVNPKLLILDEAVSSL
DLVLQAEILALLKRLQQQRDTGYLFITHDLRLVERFCQRVLVMDQGQIVETQTVGERLTL
TSAAGQALQQAVLPAFPLRRRAGAEEAVRR
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgagcctactcagtacgcagaccctctcccaccgctatcgccatgcggcactgggacgc
caagcgcagcaggtgctccaggcgatctcgttacagctgcacaggggcgagagtgtcgcc
ctgctggggcgcagcggctgcggcaagagcacgctggcgcgcctgttagtcgggctggaa
cagcccacgcaaggggtcgtctgctggcatgatacccccttgtcgcagctcgatcgccgg
gcgaaaaaggcattccgccgcgacatccagctggtgttccaggatgcgatcggcgcggtc
gatccgcgccagacggtacgggcgatcctgcgcgagccgatgcgccacctgctgtcgctc
tccccggcggagcagcgggtgcgggcgggcgagatgctacgggcggtcgagttggacgaa
ggcgtgctcgatcagcgccccccgcagctgagcggcggccagctacagcgcgtctgcctg
gcgcgggcgctggtggtcaaccccaaactgctgatcctcgacgaagccgtctctagcctc
gatctggtgctacaggccgagatcctcgcgctcctcaaacggctccagcagcagcgggac
accggttacctgttcatcacccatgatctgcgcctggtcgaacgcttctgccaacgggta
ctcgtgatggatcaagggcagatcgtcgagacgcagaccgtcggcgaacgcctgacgctc
acctccgccgccgggcaggcactccagcaggcggtgctgcccgcctttcccctgcgacgc
cgcgcgggcgcggaagaggcggtgcgccgctaa

DBGET integrated database retrieval system