KEGG   Edwardsiella piscicida C07-087: ETAC_06505Help
Entry
ETAC_06505        CDS       T02509                                 

Gene name
nikD
Definition
(GenBank) nickel transporter ATP-binding protein NikD
  KO
K15587  nickel transport system ATP-binding protein [EC:7.2.2.11]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02010  ABC transporters
Module
etc_M00440  Nickel transport system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_06505 (nikD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_06505 (nikD)
Enzymes [BR:etc01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.11  ABC-type Ni2+ transporter
     ETAC_06505 (nikD)
Transporters [BR:etc02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Nickel transporter [MD:M00440]
    ETAC_06505 (nikD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N oligo_HPY AAA_19 AAA_22 AAA_29
Motif
Other DBs
NCBI-ProteinID: AGH73422
Position
complement(1492184..1492948)
Genome map
AA seq 254 aa AA seqDB search
MPQRLDLHQISLQATRPLVLGVSLTLRRGRVLALVGGSGSGKSLTCAAALGVLPAGVRQL
AGQIRLDGVPIAPAALRGRHVATVMQNPRSAFNPLHTMASHARETCLALAKPADDDTLMR
ALTAVGLDDPLRVLQSYPFEMSGGMLQRMMIAMALLSDAPFLIADEPTTDLDAVAQARIL
DLLATIVRQRAPGMLLVTHDMGVVARLADDVAVMADGRVVEQGEVEQVFHAPRHAVTQAL
VAAHLALYGLEIAG
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgccacaacgactcgatttacaccaaatctccctccaggcgacgcgtccgctggtgctc
ggggtctcgctgaccctacgacgcggccgggtgctggcgttggtcggcggcagcggcagc
ggcaagtccctgacctgcgccgccgcgctgggcgtcttacccgccggtgtgcgccaactg
gccgggcagatccggctggatggcgtgcccatcgcccccgccgcgctacgtggccgccat
gttgccaccgtcatgcagaatccgcgcagcgcctttaatcccctgcacaccatggccagc
catgcccgagaaacctgtctggcgttggcgaaaccggcggacgacgacacgctgatgcgc
gccctgacggcggtcggattggatgaccccctgcgggtattacagagctatcccttcgag
atgagcggcggcatgctgcaacggatgatgatcgccatggcgctgctgagcgacgcgccg
tttctcatcgccgacgagccgaccaccgatctcgacgcggtggcgcaggcgcgcatcctg
gatctgctggcgacgatcgtgcgccaacgcgcgcccggcatgctgctggtcacccatgat
atgggcgtcgtcgcccgcctggcggacgatgtggcggtgatggccgacggacgggtggtg
gaacagggtgaagtcgaacaggtgttccacgcgccacgccacgccgtaacgcaggcgtta
gtcgccgcgcatttggccctgtatggactggagatcgccggatga

DBGET integrated database retrieval system