KEGG   Edwardsiella piscicida C07-087: ETAC_06575Help
Entry
ETAC_06575        CDS       T02509                                 

Definition
(GenBank) ribose-phosphate pyrophosphokinase
  KO
K00948  ribose-phosphate pyrophosphokinase [EC:2.7.6.1]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00030  Pentose phosphate pathway
etc00230  Purine metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
etc01130  Biosynthesis of antibiotics
etc01200  Carbon metabolism
etc01230  Biosynthesis of amino acids
Module
etc_M00005  PRPP biosynthesis, ribose 5P => PRPP
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ETAC_06575
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ETAC_06575
Enzymes [BR:etc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.1  ribose-phosphate diphosphokinase
     ETAC_06575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pribosyltran_N Pribosyl_synth Pribosyltran UPRTase PRTase_2
Motif
Other DBs
NCBI-ProteinID: AGH73436
Position
complement(1506712..1507659)
Genome map
AA seq 315 aa AA seqDB search
MPDMKLFAGNATPELAQRIANRLYTSLGDAAVGRFSDGEVSVQINENVRGGDIFIIQSTC
APTNDNLMELVVMVDALRRASAGRITAVIPYFGYARQDRRVRSARVPITAKVVADFLSSV
GVDRVLTVDLHAEQIQGFFDVPVDNVFGSPILLEDMLQQKLENPIVVSPDIGGVVRARAI
AKLLNDTDMAIIDKRRPRANVSQVMHIIGDVADRDCVLVDDMIDTGGTLCKAAEALKERG
AKRVFAYATHPIFSGNAIDNIKNSVIDEFVVCDTIPLAPEIKALDKVRSLTLSGMLAEAI
RRISNEESISAMFEH
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgatatgaagctttttgctggtaacgctaccccggaactagcacaacgtattgcc
aaccgtttgtacaccagcctcggcgacgccgctgtaggccgttttagtgacggcgaagtg
agcgtgcaaatcaacgaaaatgtacgcggtggtgatattttcatcatccagtccacctgt
gccccgaccaacgataacctgatggagctggttgtcatggttgacgcactgcgccgcgcc
tccgccggccgcatcacggcggtaatcccttacttcggctatgcgcgccaggatcgccgc
gtgcgctccgcccgtgtgccgatcacggcaaaagtcgtcgcagacttcctgtccagcgta
ggggttgaccgcgtactgaccgtggacctgcatgcagaacagatccagggcttcttcgac
gtaccggtagataacgtattcggcagcccgatcctgctggaagacatgctgcagcagaag
ctggaaaacccgatcgtggtttctccggacatcggcggcgtcgtacgtgcccgcgccatc
gctaaactgctcaacgataccgacatggccatcatcgataagcgtcgtccgcgcgccaac
gtctctcaggtgatgcacatcatcggtgacgttgccgatcgcgactgcgtcctggtcgac
gacatgatcgataccggcggcaccctgtgcaaagcggccgaagcgctgaaagagcgcggc
gccaagcgcgtatttgcctatgcgacccacccgatcttctccggcaacgccatcgacaac
atcaagaattccgtaatcgatgagtttgtggtgtgcgacaccattccgctggcaccggag
atcaaggcgctggacaaggtccgcagcctgacgctgtccggcatgttggccgaggccatc
cgccgcatcagcaacgaagagtccatctctgcgatgtttgaacactga

DBGET integrated database retrieval system