KEGG   Edwardsiella piscicida C07-087: ETAC_06590Help
Entry
ETAC_06590        CDS       T02509                                 

Gene name
hemA
Definition
(GenBank) glutamyl-tRNA reductase
  KO
K02492  glutamyl-tRNA reductase [EC:1.2.1.70]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00860  Porphyrin and chlorophyll metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
Module
etc_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
etc_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ETAC_06590 (hemA)
Enzymes [BR:etc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.70  glutamyl-tRNA reductase
     ETAC_06590 (hemA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GlutR_N Shikimate_DH GlutR_dimer F420_oxidored Sacchrp_dh_NADP OCD_Mu_crystall GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: AGH73439
Position
1509561..1510823
Genome map
AA seq 420 aa AA seqDB search
MSLLALGINHKTAPVSLRERVTFSPDTLDRAIESLLRQPSVQAGVVLSTCNRTELYLSVE
QRTDLRQQIVDWLCSYHQLTPEEVSDSLYWHQDNDAVSHLMRVASGLDSLVLGEPQILGQ
VKKAFSESQREQALSADLERLFQKTFSVAKRVRTETEIGASAVSVAFAACTLARQIFESL
ARLNVLLVGAGETIELVARHLHQHQVQHMMIANRTRERAQALADEVGAEVIPLADIDARL
ADADIVISSTASPLPIIGKGMVERALKARRNRPMLLVDIAVPRDIEPEAGDLANAYLYSV
DDLHAIIQGNMAQRQAAAVQAEHIVQQECANFMAWLRAQGAVDTIREYRAQAEQVRAEAE
AEALAALAQGVEAEAVIRRLAHRLTNRLIHAPTKSLQQAAGSGDAQRLQTLRDSLGLDHN
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgagtcttcttgcacttggaatcaatcataaaacggcgccggtctccctgcgggaacgg
gtaacgttttcgcctgatacgctggatcgggccattgaaagtctgctgcgacagccgtcg
gtgcaggccggggtagtgctgtcgacctgtaaccgcaccgagctctacctgagcgtagag
cagcggaccgatctgcgtcagcagatcgttgactggctgtgcagctaccatcagctgacg
ccggaggaggtgagcgacagtctctattggcatcaggataacgacgcggtcagccatctg
atgcgggtagccagcggtttggactcgttggtgctgggcgagccgcagatcttgggccag
gtgaagaaagccttttcggaatctcaacgtgagcaggcgctgtctgctgacctggagcgt
ctgtttcaaaagactttctcggtggccaagcgggtacgcacggaaacggaaatcggcgcc
agcgcggtatcggtggcgtttgccgcctgtacgctggcgcgccagatctttgagtcgctg
gcccggcttaacgtactgctggtcggggcgggcgagaccattgagctggtggcccgtcat
ctgcatcagcaccaggtgcagcatatgatgatcgccaaccgcacccgcgaacgtgcccag
gcgctggccgatgaggtcggggccgaggtgatcccgctggcggatatcgacgctcgcctg
gcggacgccgatatcgtcatcagctcgacggccagcccgctgccgatcatcggtaaaggg
atggttgagcgcgcgctgaaggcgcggcgcaacaggccgatgctgctggtggatatcgcc
gttccgcgcgacatcgagccggaggccggggatctggccaacgcctatctgtacagcgtg
gacgatctgcacgctattattcagggcaatatggcccagcggcaggcggcggcggtgcag
gccgagcatatcgtgcagcaggagtgcgccaactttatggcctggctgcgcgcgcagggg
gccgtcgataccatccgtgaataccgggcccaggcggagcaggtacgggccgaggccgaa
gccgaggcgctggcggcgctggcgcagggcgtcgaggccgaggcggtgatccgccgcctg
gcgcatcgcctgaccaaccgcctgatccatgcgccgaccaaatcccttcagcaggccgcc
ggcagcggcgatgcccagcgtctgcagacgctgcgcgacagccttgggctggatcataat
tag

DBGET integrated database retrieval system