KEGG   Edwardsiella piscicida C07-087: ETAC_06745Help
Entry
ETAC_06745        CDS       T02509                                 

Definition
(GenBank) Dihydroneopterin triphosphate pyrophosphohydolase type 2
  KO
K08310  dihydroneopterin triphosphate diphosphatase [EC:3.6.1.67]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00790  Folate biosynthesis
etc01100  Metabolic pathways
Module
etc_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ETAC_06745
Enzymes [BR:etc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.67  dihydroneopterin triphosphate diphosphatase
     ETAC_06745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX NUDIX_4
Motif
Other DBs
NCBI-ProteinID: AGH73470
Position
1542852..1543286
Genome map
AA seq 144 aa AA seqDB search
MAYKRPESILVVIYARQGGRVLMLQRRDDPDFWQSVTGSLETGESPSQAAQREVKEEVGI
DIVKEHLTLTDCQRCVEFELFAHLRHRYAPGVTRNLEHWFCLAIPAERAIPLSEHLAYRW
LDAAGAAGLTKSWSNRQAIEQFVP
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atggcctataagcgtccggaatccatcctggtggtgatctatgcccgccaggggggacgg
gtgctgatgttgcagcggcgcgacgatcccgatttctggcagtcggtaaccggcagcctg
gaaacgggagagtcgccgtcgcaggccgcgcagcgtgaagtaaaggaagaagtgggtatc
gacatcgtcaaggagcatttgacgctgacggactgccagcgctgcgtggagtttgaactg
tttgcgcacctgcgccatcgctatgcgcccggcgtaacgcgtaacctagagcattggttc
tgtctggccatccccgcggagcgggcgatcccgctcagcgaacatctggcctaccgttgg
ctggatgccgcaggcgcggccggactgaccaagtcctggagtaatcggcaggcgatcgaa
cagttcgtaccttga

DBGET integrated database retrieval system