KEGG   Edwardsiella piscicida C07-087: ETAC_06770Help
Entry
ETAC_06770        CDS       T02509                                 

Gene name
znuB
Definition
(GenBank) high-affinity zinc transporter membrane component
  KO
K09816  zinc transport system permease protein
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02010  ABC transporters
Module
etc_M00242  Zinc transport system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_06770 (znuB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_06770 (znuB)
Transporters [BR:etc02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Zinc transporter [MD:M00242]
    ETAC_06770 (znuB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC-3 FecCD HemY_N
Motif
Other DBs
NCBI-ProteinID: AGH73475
Position
complement(1546485..1547270)
Genome map
AA seq 261 aa AA seqDB search
MIELLLPGWLAGALLALAAGPLGSFVVWRRMSYFGDTLAHASLLGVAFGLLLDVNPFYAV
IAVTLLLACMLVWLERRPLLGIDTLLGIMAHSALSLGLVVVALMSNVRVDLMAYLFGDLL
AVTYQDVVMIALGVALVLALLLWQWRALLSMTISPELAHVDGVALGRVKLLLMLTTALTI
GLAMKFVGALIITSLLIIPAATARRFARTPEQMAAGAVLAGLLAISGGLAFSAWYDTPAG
PSVVLCAALLFILSLGRRQSA
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgattgaactgttgctgcccggctggctggccggcgcgctgctggcgctggcggcgggc
cccttgggatcgttcgtggtatggcgacgcatgtcctactttggcgataccctcgcccac
gcctcgctgctcggcgttgccttcggcctattactggatgtaaacccgttctatgcggtg
atcgccgtcacgctgctgctggcctgtatgctggtctggctggagcgccgccccctgctg
ggcattgacaccctgctgggcatcatggcgcacagcgcgctttcgctggggctggtcgtg
gtggcgctgatgtccaacgtccgcgtcgatctgatggcctacctgttcggcgatctgctg
gcggtaacctaccaggatgtcgtgatgatagcgcttggcgtcgcgctggtgctggcgctg
ctgctgtggcaatggcgcgccctgctgtcgatgaccatcagcccggagcttgcccacgtt
gacggtgtcgccctggggcgagtgaagctgctgctgatgctgaccaccgccctgaccatc
ggcctggcgatgaagtttgtcggcgcgctgatcatcacctcgctgctgatcattccggcg
gcgaccgcccgtcgctttgcccgcaccccggagcaaatggcggccggtgccgtgctggcc
ggcctgttggccatcagcggcggtctggcgttctccgcctggtatgataccccggcggga
ccgtcggtggtgctgtgcgccgccctgctgtttatcctcagcctcgggcgtcgccagagc
gcctga

DBGET integrated database retrieval system