KEGG   Edwardsiella piscicida C07-087: ETAC_06775Help
Entry
ETAC_06775        CDS       T02509                                 

Definition
(GenBank) Zinc ABC transporter ATP-binding protein ZnuC
  KO
K09817  zinc transport system ATP-binding protein [EC:7.2.2.-]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02010  ABC transporters
Module
etc_M00242  Zinc transport system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_06775
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_06775
Transporters [BR:etc02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Zinc transporter [MD:M00242]
    ETAC_06775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_25 AAA_29 RsgA_GTPase AAA_16 SMC_N Rad17 AAA_22 AAA_23 AAA_PrkA AAA_30 AAA
Motif
Other DBs
NCBI-ProteinID: AGH73476
Position
complement(1547263..1548015)
Genome map
AA seq 250 aa AA seqDB search
MITLQHVAVRFGSRDVLDNVSLTLRRGRILTLLGPNGAGKSTLVRVVLGLVTPTRGERTT
RSGLTIGYVPQKLYLDATLPLTVERFMRLRPGVKRQDVLPALQRVQAGHLLKQPMQKLSG
GENQRVLLARALLNTPDLLVLDEPTAGVDVNGQLALYDLIDRLRHELNCAVLMVSHDLHL
VMAKTDDVLCLNQHICCSGTPETVASHPQFIAMFGAHGAQQLAVYRHHHNHRHDLCGKII
LKTRSGEADD
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
ttgatcaccctgcagcacgtcgccgtgcgcttcgggagccgcgatgtactggacaacgtc
tccctcacgctgcggcgcgggcgaatcctgaccctactgggccccaacggcgccggtaaa
tccaccctggtgcgcgtcgttctggggctggtcacgcccacgcgtggcgaacgcaccacc
cgctcggggctgacgattggctatgttccccagaagctgtatctggacgccaccctgccg
ctgacggtcgagcgtttcatgcgtctgcgccccggcgtaaagcgccaggacgtgctgccg
gcgctgcagcgagtgcaggccgggcacctgctcaagcagccgatgcagaagctctccggc
ggcgaaaatcagcgtgtactgctggcgcgggccctgctcaacaccccggatctgctggtg
ctggatgagccgaccgccggggtagacgtcaacggtcagctggcgctgtatgatctgatc
gaccgcctgcgccatgagcttaactgcgcggtgctgatggtgtcgcacgatctgcatctg
gtgatggcgaaaaccgatgacgtcctgtgcctgaaccagcatatctgctgctccggcacc
cctgagacagtcgccagccacccgcagtttatcgccatgttcggcgctcacggcgcccag
cagctggcggtctatcgccaccaccacaaccaccgccacgatctgtgcggtaaaattatt
ctcaagacacgcagcggagaggccgatgattga

DBGET integrated database retrieval system