KEGG   Edwardsiella piscicida C07-087: ETAC_06780Help
Entry
ETAC_06780        CDS       T02509                                 

Gene name
znuA
Definition
(GenBank) high-affinity zinc transporter periplasmic component
  KO
K09815  zinc transport system substrate-binding protein
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc02010  ABC transporters
Module
etc_M00242  Zinc transport system
Brite
KEGG Orthology (KO) [BR:etc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ETAC_06780 (znuA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:etc02000]
    ETAC_06780 (znuA)
Transporters [BR:etc02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Zinc transporter [MD:M00242]
    ETAC_06780 (znuA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ZnuA preATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: AGH73477
Position
1548115..1549125
Genome map
AA seq 336 aa AA seqDB search
MIPQKNIIKRTLIASALSLCALAGSAQADVVTSVRPLGFIAAAIADGVMPTQVLLPDGAS
PHDYALRPSDIKRLRDADLVVWIGPEMESFLEKPTQQLENNKNLILSTLPGVRSQLIAGD
DDDDHDHHTSQRENHAENSDSSGSHIVTNGAGAGLESDHDHDHGQYNMHIWLSPAIAKQV
AIAIHDRLVQRSPQNKDKLDVNLRKFEQQLEQTEKKVGIMLRPVQDKGYFVFHDAYGYFE
KTFGLTPLGHFTVNPEIQPGARRLHQIRTQLVEQKAVCVFAEPQFRPAVISAIAQGTPVR
QGTLDPLGSAIPLSADSYMVFLTTLAHQYSSCLKGD
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgataccgcaaaaaaatataattaaacgcacgcttattgcttccgcgctgtcgctgtgt
gcgctggcgggcagcgcgcaggctgacgtggtgacttcggttcgaccgctgggtttcatc
gcggcggcgattgccgacggcgtgatgccgacgcaggttctgctgcctgacggcgcttcg
ccccacgattatgcgctgcgtccctcggatatcaaacgattgcgtgacgctgacctggtg
gtatggataggtccggaaatggagagttttcttgaaaaaccgactcaacagctagaaaat
aacaaaaatcttattctcagcaccctgccgggcgtgcgtagtcaactcattgcgggggat
gatgatgatgatcacgatcatcatacttcgcagcgcgaaaatcatgcggaaaattccgat
tcttccgggtcacatattgttacaaatggcgccggcgctggcttggagagcgatcacgat
cacgatcacggtcaatataatatgcatatttggctctctccggcgatagcgaaacaggtg
gcgattgcgattcatgaccgattagtgcaacgaagcccacaaaataaagacaaactggat
gtcaacctacgtaaattcgagcaacaacttgagcagacagaaaagaaagttggtatcatg
ctgcggcctgtgcaggataaagggtattttgtctttcacgatgcctatggttacttcgag
aaaacctttggcctgactccgttggggcatttcacggtcaatcccgagatacagcctggc
gcacggcgcttacaccaaattcgaacacagctggttgagcaaaaagcggtttgcgttttt
gctgagccacagttcaggccagccgttatctcggcgattgcgcaggggacccctgttcgg
cagggtacgctagatcccctgggaagcgcgatcccactgagtgcggacagctatatggtc
tttttgaccacgctggcgcaccagtattcaagctgcctgaagggagattaa

DBGET integrated database retrieval system