KEGG   Edwardsiella piscicida C07-087: ETAC_06800Help
Entry
ETAC_06800        CDS       T02509                                 

Definition
(GenBank) pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00010  Glycolysis / Gluconeogenesis
etc00230  Purine metabolism
etc00620  Pyruvate metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
etc01130  Biosynthesis of antibiotics
etc01200  Carbon metabolism
etc01230  Biosynthesis of amino acids
Module
etc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
etc_M00002  Glycolysis, core module involving three-carbon compounds
etc_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
etc_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ETAC_06800
   00620 Pyruvate metabolism
    ETAC_06800
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ETAC_06800
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:etc04131]
    ETAC_06800
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:etc04147]
    ETAC_06800
Enzymes [BR:etc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     ETAC_06800
Membrane trafficking [BR:etc04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    ETAC_06800
Exosome [BR:etc04147]
 Exosomal proteins
  Proteins found in most exosomes
   ETAC_06800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PK PK_C DUF3006
Motif
Other DBs
NCBI-ProteinID: AGH73481
Position
complement(1552536..1553978)
Genome map
AA seq 480 aa AA seqDB search
MSRRLRRTKIVTTLGPATDRDNNLEKIISAGANVMRLNFSHGTPEDHQLRANKVREIAAK
LGRHVAILGDLQGPKIRVSTFKEGKVFLNVGDKFLLDATLDKGEGDKEKVGIDYKRLPED
VVPGDILLLDDGRVQLKVLSVQEDKVFTEVTVGGPLSNNKGINKLGGGLSADALTEKDKA
DILTAAKIGVDYLAVSFPRCGEDLNYARRLARDAGCEAKIVAKVERAEAVASDEAMDDVI
LAADVVMVARGDLGVEIGDPELVGIQKKLIRRARKLNRVVITATQMMESMITNPMPTRAE
VMDVANAVLDGTDAVMLSAETAAGQYPAETVAAMARVCLGAEKIPSINISKHRLDAQFDN
TEEAVAMSAMYAANHLKGVTAIIAMTESGRTALMMSRISSGLPIFAMSRHERTLNLTALY
RGVTPVHFDSHTDGVAAAQAAANLLRDKGFLVSGDLVIVTQGDQMDTIGSTNTCRTLRVE
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgtccagacggctcagaagaaccaaaatcgttaccacgcttggcccggctaccgatcgc
gacaataatctggaaaagattatctccgccggcgccaacgtgatgcgtcttaacttttca
cacggcacgccggaagatcaccagctgcgcgccaacaaagtccgtgaaatcgccgccaaa
ctcggtcgtcatgtcgccattctcggggacctgcagggtcctaaaatccgggtatccacc
tttaaggaaggtaaagttttcctcaacgttggggataaattcctgctggatgccacgctg
gacaagggcgaaggcgataaagagaaggtgggcatcgactataagcggctgccggaagat
gtggtgccgggcgatattctgctgctcgacgatggccgtgttcagctgaaggtgctctcc
gtacaggaagataaggtgttcaccgaggtcaccgtcggcggcccgctgtccaacaataaa
gggatcaacaagctgggcggcgggctctctgccgatgccctgacggaaaaggacaaggcc
gatatcctgaccgccgccaagatcggtgtcgactatctggccgtctccttcccgcgctgc
ggggaagatctcaactatgcccgtcgtctggcgcgcgatgccggctgcgaagccaagatc
gtcgccaaggtcgagcgtgccgaggccgttgccagcgacgaagcgatggatgatgtgatc
ctggccgccgacgtcgtgatggtcgcccgcggcgatctgggggttgaaatcggcgatccg
gagctggtcgggatccagaaaaagctgatccgccgcgcccgcaagctgaaccgcgtcgtg
atcaccgcgacccagatgatggagtccatgatcaccaacccgatgccgacccgtgcggag
gtcatggacgtggccaacgccgtactggacggtaccgatgccgtgatgctgtctgccgag
accgccgcgggccagtacccggccgaaaccgtggccgccatggcgcgcgtctgcctgggc
gccgagaagatccccagcatcaatatctccaagcaccgccttgatgcccagttcgacaat
acggaagaggcggtcgccatgtccgccatgtacgccgccaaccacctcaagggggtaacg
gccatcattgcgatgacggagtccggacgcaccgcgctgatgatgtcccggatcagctct
ggcctgccgatcttcgccatgtcccgccatgagcgcaccctgaacctgacggccctgtac
cgcggcgtcacgccggtgcactttgacagccacaccgacggcgtagccgcggcccaggcg
gcggcgaatctgctgcgggataaaggcttcctggtctccggcgatctggtgatcgtcaca
cagggcgatcagatggacaccatcggcagcaccaacacctgccgtaccctgcgcgtagag
taa

KEGG   Edwardsiella piscicida C07-087: ETAC_08480Help
Entry
ETAC_08480        CDS       T02509                                 

Definition
(GenBank) pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
etc  Edwardsiella piscicida C07-087
Pathway
etc00010  Glycolysis / Gluconeogenesis
etc00230  Purine metabolism
etc00620  Pyruvate metabolism
etc01100  Metabolic pathways
etc01110  Biosynthesis of secondary metabolites
etc01120  Microbial metabolism in diverse environments
etc01130  Biosynthesis of antibiotics
etc01200  Carbon metabolism
etc01230  Biosynthesis of amino acids
Module
etc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
etc_M00002  Glycolysis, core module involving three-carbon compounds
etc_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
etc_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:etc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ETAC_08480
   00620 Pyruvate metabolism
    ETAC_08480
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ETAC_08480
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:etc04131]
    ETAC_08480
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:etc04147]
    ETAC_08480
Enzymes [BR:etc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     ETAC_08480
Membrane trafficking [BR:etc04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    ETAC_08480
Exosome [BR:etc04147]
 Exosomal proteins
  Proteins found in most exosomes
   ETAC_08480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PK PK_C HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: AGH73817
Position
1930462..1931874
Genome map
AA seq 470 aa AA seqDB search
MKKTKIVCTIGPKTESEEMLGKLLNAGMNVMRLNFSHGDYEEHGQRIKNLRAVMEKTGQK
AAILLDTKGPEIRTMKLEGGNDVSLTAGQTFTFTTDQSVIGNSDRVAVTYPGFAADLRIG
NTVLVDDGLIGMEVTDVTESTVVCKVLNNGDLGENKGVNLPGVSIQLPALAEKDKRDLVF
GCEQGVDFVAASFIRKRADVLEIREHLKAHGGEQIQIISKIENQEGLNNFDEILEASDGI
MVARGDLGVEIPVEEVIFAQKMMIEKCNRARKVVITATQMLDSMIKNPRPTRAEAGDVAN
AILDGTDAVMLSGESAKGKYPLEAVGIMATICERTDRVMQSRIDTLHDSRKLRITEAVCR
GAVETAEKLDAPLIVVATAGGKSAKAVRKYFPDAMILALTTNPVTARQLILSKGVIPMMV
KEIASTDDFYRIGKDAALESGLAQKGDVVVMVSGALVPSGTTNTASVHVL
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaccaaaatcgtatgcaccatcggtccgaagaccgaatccgaagagatgctg
ggtaaactgctgaacgcaggcatgaacgtaatgcgtctgaacttctcccacggtgactat
gaagaacacggccagcgcatcaaaaacctgcgcgctgtcatggagaagaccggccagaaa
gccgctatcctgctggacaccaagggcccggaaatccgcaccatgaagctggaaggcggc
aatgacgtctccctgaccgccggccagaccttcaccttcaccaccgaccagagcgtcatc
ggcaacagcgaccgcgtcgccgtcacctacccgggcttcgccgctgacctgcgcatcggc
aacaccgtgctggtggacgatggcctgatcggcatggaagtgaccgatgtcaccgaaagc
accgtggtgtgcaaggttctgaacaacggcgacctgggcgagaacaaaggcgttaacctg
ccgggcgtgtctatccagctgccggcgctggccgaaaaagacaagcgcgacctagtcttt
ggctgcgagcagggcgttgacttcgtcgccgcctctttcatccgtaagcgcgccgacgta
ctggaaatccgtgagcacctgaaggcccacggcggcgagcagatccagatcatctccaag
atcgaaaaccaggaaggcctgaacaacttcgacgaaatcctggaagcctccgacggcatc
atggttgcccgtggcgatctgggcgttgaaatcccggtagaagaagttatcttcgcgcag
aagatgatgatcgaaaaatgcaaccgcgcccgcaaagtggtcatcaccgcgacccagatg
ctggactccatgatcaaaaacccgcgtccgacccgtgcggaagccggtgacgttgccaac
gccatcctcgacggcaccgacgccgtcatgctgtccggcgaaagcgccaagggtaaatac
ccgctggaagccgtcggcatcatggcgaccatctgtgaacgtaccgatcgcgtcatgcag
agccgtatcgacaccctgcacgactcacgtaagctgcgcatcaccgaagcggtatgccgc
ggcgcggtagagaccgccgagaagctggatgccccgctgatcgtcgttgccaccgccggc
ggcaaatccgccaaggccgtccgtaagtacttcccggatgcgatgatcctggccctgacc
accaacccggtcaccgcccgtcagctgatcctgagcaaaggcgtcatcccgatgatggtc
aaagagatcgcctctaccgacgatttctatcgcatcggtaaagacgctgccctggaaagt
ggtctggcgcagaaaggcgacgttgtcgtcatggtctccggcgcactggtaccgagcggc
accaccaacaccgcctcagtacacgtgctctga

DBGET integrated database retrieval system